Plant FIBer expression Database

Lus10019861 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G34412 263 / 4e-91 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014052
[exp]
338 / 5e-121 AT4G34412 259 / 7e-90 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G141400
[exp]
286 / 1e-100 AT4G34412 265 / 8e-92 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08617 CGI-121 Kinase binding protein CGI-121
Representative CDS sequence
>Lus10019861 pacid=23164051 polypeptide=Lus10019861 locus=Lus10019861.g ID=Lus10019861.BGIv1.0 annot-version=v1.0
ATGAAGGAATTCCAAATCGACTTGAAGAACACTCTTTCTCTCGCCCTCTTCACTGAAGTCACCAATTCCAGGGAACTTCTTGACTCTATGCAAGCTGGGA
ATCTGGAGTTGGAAGTAGCCTTTATGAACGCATCACTTGTCCCAGATGCCTTCCCTGTTCTCGCCGCAGCACACAAGGCTCTAATCACAAAGTCTCGAGA
TTCATTGACAACCCGAACGCTTCATTCCGAGCTTGTTTACAATTATTCTGGATCCAAGCATATTACAGAGTCCCTAAAAAGATGTGGCATCTCAGACAGC
TCAACATACGTCCTCGCAGCTCGCTTCAATGCATCACCAAAAGATATGAAAACGGTCGAGAAACTTATCAACGGTAAGGAAGTCGAGTTAGATGAGCTGG
AACGCCGATCTAATCTAGCTCAAATCCTTAAGCACTACAAGATTTCCACAGCAGAGTTGGGGATTTCGTCGCTTGCTGATGCAATAACTTGCCGGATTGC
TTCCCGGGATGCACTGTGA
AA sequence
>Lus10019861 pacid=23164051 polypeptide=Lus10019861 locus=Lus10019861.g ID=Lus10019861.BGIv1.0 annot-version=v1.0
MKEFQIDLKNTLSLALFTEVTNSRELLDSMQAGNLELEVAFMNASLVPDAFPVLAAAHKALITKSRDSLTTRTLHSELVYNYSGSKHITESLKRCGISDS
STYVLAARFNASPKDMKTVEKLINGKEVELDELERRSNLAQILKHYKISTAELGISSLADAITCRIASRDAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G34412 unknown protein Lus10019861
[exp]
0 1
AT1G02840 ATSRP34, SR1, S... Serine/Arginine-Rich Protein S... Lus10008218
[exp]
3.2 0.8246
AT5G14640 ATSK13 shaggy-like kinase 13 (.1) Lus10022254
[exp]
16.2 0.7878
AT1G15660 CENP-C CENP-C HOMOLOGUE, centromere p... Lus10011470
[exp]
20.9 0.7902
AT5G13020 AtEML3, ACK1 EMSY-like 3, Emsy N Terminus (... Lus10031799
[exp]
27.5 0.7552
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10040161
[exp]
40.8 0.7743
AT1G08970 CCAAT NF-YC9, HAP5C "nuclear factor Y, subunit C9"... Lus10021934
[exp]
42.5 0.7561
AT3G07590 Small nuclear ribonucleoprotei... Lus10016068
[exp]
51.4 0.7428
AT5G42700 B3 AP2/B3-like transcriptional fa... Lus10019873
[exp]
52.2 0.7291
AT1G67590 Remorin family protein (.1.2) Lus10026481
[exp]
56.7 0.7396
AT3G01410 Polynucleotidyl transferase, r... Lus10014521
[exp]
61.3 0.7293

Lus10019861 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.