Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02234 [flax] [poplar] CDI Cyclin-dependent kinase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10019876 pacid=23164093 polypeptide=Lus10019876 locus=Lus10019876.g ID=Lus10019876.BGIv1.0 annot-version=v1.0 ATGTCAACAACAACCACCACCGATTCCCAGATCTCTCCTCCTCCTTCTCCACCTCCTTCTCCTCGCCAGGTGAACGTGCAGGAGGAGCAGGAAGGAGGAG ATCCAACTGCCGAAGAGCTGGATGAGTTCTTCGCCGCAGCGGAGAAGGACGACCAGAGACGATTTGCAGAGAAGTGA
AA sequence Show only first row Show all	>Lus10019876 pacid=23164093 polypeptide=Lus10019876 locus=Lus10019876.g ID=Lus10019876.BGIv1.0 annot-version=v1.0 MSTTTTTDSQISPPPSPPPSPRQVNVQEEQEGGDPTAEELDEFFAAAEKDDQRRFAEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019876 [exp]	0	1
AT5G58330			lactate/malate dehydrogenase f...		Lus10038668 [exp]	6.3	0.9046
AT3G23760			unknown protein		Lus10043212 [exp]	6.3	0.8882
AT5G39980			Tetratricopeptide repeat (TPR)...		Lus10034342 [exp]	6.7	0.8551
AT5G58330			lactate/malate dehydrogenase f...		Lus10037935 [exp]	13.0	0.8794
AT3G02450			cell division protein ftsH, pu...		Lus10034097 [exp]	14.3	0.8735
AT1G21790			TRAM, LAG1 and CLN8 (TLC) lipi...		Lus10018165 [exp]	15.3	0.8457
AT3G26570		ORF02, PHT2;1	phosphate transporter 2;1 (.1....		Lus10036858 [exp]	16.3	0.8552
AT5G51050		APC2	ATP/phosphate carrier 2, Mitoc...		Lus10032522 [exp]	19.5	0.8504
AT1G60000			RNA-binding (RRM/RBD/RNP motif...		Lus10023723 [exp]	21.5	0.8769
AT2G46420			Plant protein 1589 of unknown ...		Lus10004015 [exp]	21.9	0.8552

Compare expression of checked genes

Lus10019876 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.