Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06790 97 / 2e-26 RNA polymerase Rpb7 N-terminal domain-containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035380 [exp] 178 / 2e-58 AT1G06790 235 / 3e-79 RNA polymerase Rpb7 N-terminal domain-containing protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G044500 [exp] 119 / 2e-35 AT1G06790 228 / 1e-76 RNA polymerase Rpb7 N-terminal domain-containing protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [flax] [poplar] OB PF08292 [flax] [poplar] RNA_pol_Rbc25 RNA polymerase III subunit Rpc25
Representative CDS sequence Show only first row Show all	>Lus10019886 pacid=23163968 polypeptide=Lus10019886 locus=Lus10019886.g ID=Lus10019886.BGIv1.0 annot-version=v1.0 ATGGTGGTTTTCCGTCCATTTTTAGGAGAGGTTATCATTGCCAAACTTAAGGTATCAGATGTAGATGGCCTTCGTCATTTTTTCGACGATATCATTGTGC CGGTTCATCAACTTCCCGAACCACGCCATCACATTCCAGATCCAGACTGCCGGTACAAAGTGAGATGGATATGGGAATACGATATCGAGGAGACAGTAAA CCCTGAGGAGTACAACATTGACGGCTTTGATGAGATTAAATTCCAGGTTATAAATGTGACTTTCCCAACACTTCCAATTGAGCCGCAAGAGAAGCCTTTC GCCCCGATGGTAGTTACTATGTAG
AA sequence Show only first row Show all	>Lus10019886 pacid=23163968 polypeptide=Lus10019886 locus=Lus10019886.g ID=Lus10019886.BGIv1.0 annot-version=v1.0 MVVFRPFLGEVIIAKLKVSDVDGLRHFFDDIIVPVHQLPEPRHHIPDPDCRYKVRWIWEYDIEETVNPEEYNIDGFDEIKFQVINVTFPTLPIEPQEKPF APMVVTM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06790			RNA polymerase Rpb7 N-terminal...		Lus10019886 [exp]	0	1
AT1G18720			Protein of unknown function (D...		Lus10001647 [exp]	5.7	1.0000
					Lus10002009 [exp]	6.2	1.0000
					Lus10002449 [exp]	6.9	1.0000
AT5G42800		M318, TT3, DFR	dihydroflavonol 4-reductase (....		Lus10006195 [exp]	8.9	1.0000
					Lus10006079 [exp]	10.4	1.0000
AT5G19580			glyoxal oxidase-related protei...		Lus10011111 [exp]	11.3	1.0000
					Lus10010414 [exp]	13.9	1.0000
AT1G14220			Ribonuclease T2 family protein...		Lus10015409 [exp]	14.4	1.0000
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10010628 [exp]	15.0	1.0000
AT4G28780			GDSL-like Lipase/Acylhydrolase...		Lus10023578 [exp]	15.6	1.0000

Compare expression of checked genes

Lus10019886 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.