Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05880 64 / 8e-16 RCI2A RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) AT3G05890 62 / 6e-15 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT2G38905 59 / 8e-14 Low temperature and salt responsive protein family (.1) AT1G57550 51 / 1e-10 Low temperature and salt responsive protein family (.1) AT4G30650 48 / 3e-09 Low temperature and salt responsive protein family (.1) AT4G30660 47 / 7e-09 Low temperature and salt responsive protein family (.1.2) AT4G28088 46 / 2e-08 Low temperature and salt responsive protein family (.1) AT2G24040 45 / 3e-08 Low temperature and salt responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014028 [exp] 85 / 5e-24 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10029449 [exp] 66 / 2e-16 ND 89 / 1e-25 Lus10029450 [exp] 65 / 4e-16 ND 87 / 6e-25 Lus10005948 [exp] 65 / 2e-15 ND 85 / 5e-23 Lus10040370 [exp] 59 / 8e-14 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10023489 [exp] 59 / 8e-14 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10036592 [exp] 42 / 4e-07 AT4G30660 116 / 4e-36 Low temperature and salt responsive protein family (.1.2) Lus10035809 [exp] 42 / 4e-07 AT4G30660 116 / 5e-36 Low temperature and salt responsive protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G001600 [exp] 64 / 6e-16 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002250 [exp] 62 / 4e-15 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) Potri.005G002100 [exp] 61 / 8e-15 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.008G044300 [exp] 58 / 2e-13 AT2G38905 100 / 4e-30 Low temperature and salt responsive protein family (.1) Potri.010G217200 [exp] 57 / 4e-13 AT2G38905 98 / 2e-29 Low temperature and salt responsive protein family (.1) Potri.018G105100 [exp] 47 / 8e-09 AT4G28088 91 / 1e-25 Low temperature and salt responsive protein family (.1) Potri.006G182500 [exp] 42 / 3e-07 AT4G28088 91 / 5e-26 Low temperature and salt responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01679 [flax] [poplar] Pmp3 Proteolipid membrane potential modulator
Representative CDS sequence Show only first row Show all	>Lus10019890 pacid=23164007 polypeptide=Lus10019890 locus=Lus10019890.g ID=Lus10019890.BGIv1.0 annot-version=v1.0 ATGTCGAGGGGAACAGATAACTTCATAGGGATAATACTGGCGATCCTGTTGCCGCCACTGGGAGTGTTCCTAAAGTTTGGGTGTGAGACGGAGTTCTGGA TCTGTTTGGTCCTCACCTTCCTTGGCTACATCCCTGGCATCGTCTACGCCATCTACGTCATCACTAAGTGA
AA sequence Show only first row Show all	>Lus10019890 pacid=23164007 polypeptide=Lus10019890 locus=Lus10019890.g ID=Lus10019890.BGIv1.0 annot-version=v1.0 MSRGTDNFIGIILAILLPPLGVFLKFGCETEFWICLVLTFLGYIPGIVYAIYVITK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05880		RCI2A	RARE-COLD-INDUCIBLE 2A, Low te...		Lus10019890 [exp]	0	1
AT1G22640	MYB	AtMYB3	ARABIDOPSIS THALIANA MYB DOMA...		Lus10001043 [exp]	1.4	0.8592
AT3G05880		RCI2A	RARE-COLD-INDUCIBLE 2A, Low te...		Lus10014028 [exp]	2.4	0.8530
AT2G04865			Aminotransferase-like, plant m...		Lus10035574 [exp]	4.5	0.8063
AT5G07800			Flavin-binding monooxygenase f...		Lus10003474 [exp]	4.6	0.8142
AT5G25390	AP2_ERF	SHN3, SHN2	shine3, Integrase-type DNA-bin...		Lus10002912 [exp]	5.7	0.8567
AT4G37220			Cold acclimation protein WCOR4...		Lus10012035 [exp]	5.9	0.8241
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009624 [exp]	7.5	0.8474
ATCG00120		ATCG00120.1, AT...	ATP synthase subunit alpha (.1...		Lus10004894 [exp]	13.0	0.8123
					Lus10028567 [exp]	13.2	0.8213
ATCG00680		ATCG00680.1, PS...	photosystem II reaction center...		Lus10006593 [exp]	14.1	0.8087

Compare expression of checked genes

Lus10019890 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.