Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026491 [exp] 73 / 7e-19 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G087000 [exp] 39 / 1e-05 AT5G03120 54 / 3e-11 unknown protein Potri.006G130400 [exp] 36 / 0.0002 AT5G03120 62 / 3e-14 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019921 pacid=23164029 polypeptide=Lus10019921 locus=Lus10019921.g ID=Lus10019921.BGIv1.0 annot-version=v1.0 ATGCTTAATTTCAATCCTAGAGAAAAAAAATGGTTGTCGTTAGTGGAAAGCAAGGAACCGATGAAGACGGCGGCGGTGGCAGAGGCAGAGTACGATGTAG ACTACAGGGGACCGGAGACTCACCCGGCGGATTTCCCACCGGCGCCGACCGGTCATTTTAGGGGCAGGACACCATTTCACCGCCGGTGA
AA sequence Show only first row Show all	>Lus10019921 pacid=23164029 polypeptide=Lus10019921 locus=Lus10019921.g ID=Lus10019921.BGIv1.0 annot-version=v1.0 MLNFNPREKKWLSLVESKEPMKTAAVAEAEYDVDYRGPETHPADFPPAPTGHFRGRTPFHRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019921 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009623 [exp]	3.7	0.9136
					Lus10038294 [exp]	7.0	0.8634
AT3G61260			Remorin family protein (.1)		Lus10027460 [exp]	7.2	0.8284
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10000957 [exp]	8.5	0.8590
AT2G21140		ATPRP2	proline-rich protein 2 (.1)		Lus10042392 [exp]	10.0	0.8808
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Lus10006413 [exp]	12.1	0.8866
AT1G11600		CYP77B1	"cytochrome P450, family 77, s...		Lus10007658 [exp]	13.5	0.8388
AT4G34770			SAUR-like auxin-responsive pro...		Lus10025909 [exp]	13.7	0.8426
AT3G29030		ATEXP5, ATHEXPA...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10033011 [exp]	16.5	0.8403
AT4G02630			Protein kinase superfamily pro...		Lus10012664 [exp]	16.5	0.8361

Compare expression of checked genes

Lus10019921 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.