Lus10019935 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1)
AT2G37190 301 / 1e-106 Ribosomal protein L11 family protein (.1)
AT3G53430 301 / 2e-106 Ribosomal protein L11 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023186 328 / 3e-117 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1)
Lus10026506 328 / 3e-117 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1)
Lus10041308 320 / 7e-114 AT5G60670 305 / 6e-108 Ribosomal protein L11 family protein (.1)
Lus10037402 315 / 4e-112 AT5G60670 300 / 4e-106 Ribosomal protein L11 family protein (.1)
Lus10015086 142 / 1e-44 AT3G53430 134 / 5e-42 Ribosomal protein L11 family protein (.1)
Lus10015085 102 / 2e-29 AT5G60670 95 / 4e-27 Ribosomal protein L11 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G145506 311 / 2e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.018G145504 311 / 2e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.018G146600 311 / 2e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.018G145200 311 / 2e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.006G077200 308 / 2e-109 AT2G37190 295 / 7e-104 Ribosomal protein L11 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Representative CDS sequence
>Lus10019935 pacid=23164081 polypeptide=Lus10019935 locus=Lus10019935.g ID=Lus10019935.BGIv1.0 annot-version=v1.0
ATGCCGCCGAAGTTCGATCCATCTCAGGTAGTGGATGTGTTCGTACGCGTGACCGGCGGCGAGGTCGGAGCTGCTTCATCTCTGGCTCCCAAGATCGGTC
CCCTGGGTCTCTCCCCGAAGAAGATTGGAGAAGACATCGCCAAGGAGACCAGCAAGGACTGGAAGGGCTTGCGTGTCACCGTCAAGCTCACCGTCCAGAA
CCGTCAGGCGAAGGTAACGGTTGTGCCGTCCGCTGCTGCTCTGGTCATCAAGGCCTTGAAGGAGCCCGAGCGCGACAGGAAGAAGACCAAGAACATCAAG
CATAACGGGAACATCTCGCTTGATGACGTGATCGAGATTGCTAAGGTGATGAAGCCGCGATCGATGGCCAAGGAGTTGAGTGGAACTGTGAAGGAGATTC
TCGGTACCTGCGTCTCCGTAGGGTGTACCGTCGATGGGAAGGACCCGAAGGACCTCCAGGAGGAGATCAACGACGGTGATGTTGAAATCCCCTCCGAGTA
A
AA sequence
>Lus10019935 pacid=23164081 polypeptide=Lus10019935 locus=Lus10019935.g ID=Lus10019935.BGIv1.0 annot-version=v1.0
MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETSKDWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIK
HNGNISLDDVIEIAKVMKPRSMAKELSGTVKEILGTCVSVGCTVDGKDPKDLQEEINDGDVEIPSE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G60670 Ribosomal protein L11 family p... Lus10019935 0 1
AT5G60670 Ribosomal protein L11 family p... Lus10026506 1.0 0.9674
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10036855 2.0 0.9520
AT4G23620 Ribosomal protein L25/Gln-tRNA... Lus10011005 2.0 0.9416
AT1G07930 GTP binding Elongation factor ... Lus10015070 2.2 0.9378
AT1G23290 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Riboso... Lus10026698 2.4 0.9467
AT2G09990 Ribosomal protein S5 domain 2-... Lus10031970 3.5 0.8914
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10024161 7.4 0.8660
AT3G07770 Hsp89.1, AtHsp9... HEAT SHOCK PROTEIN 90-6, HEAT ... Lus10006374 7.5 0.8716
AT1G61870 PPR336 pentatricopeptide repeat 336 (... Lus10006769 9.2 0.8279
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10006207 10.9 0.8905

Lus10019935 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.