Lus10019938 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026509 112 / 9e-34 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G127750 37 / 0.0003 ND /
PFAM info
Representative CDS sequence
>Lus10019938 pacid=23164088 polypeptide=Lus10019938 locus=Lus10019938.g ID=Lus10019938.BGIv1.0 annot-version=v1.0
ATGTCGAAAATCGACGATGGCGACAGAAGACTGTATCAATGCGCAAGAAAGTACGACCAGATCGTGAACCAAGAAACTGAAAAGTTCTCTTCTTTCTTCT
TTCGGTTTGACGAGCTGGTTGAGATGATGACTGCCAGAGCCAGGCCGCCCAAGCGGCGCAGAATCTCATCATCGAGTTCCAAAGAAACTAACAAGGCAGC
TGTGGCCGAGATATCCCCGTGTGAAGATGATAATGACGGCAAAGTATTTGTGGAGACCATAACCAAGTTTCTCCAGGAACTAAGTGATGATCAGCCTGCT
GCTGAAACGGATTCCTCATCTGCCTCCAGAGATTCTCCAGAGTAG
AA sequence
>Lus10019938 pacid=23164088 polypeptide=Lus10019938 locus=Lus10019938.g ID=Lus10019938.BGIv1.0 annot-version=v1.0
MSKIDDGDRRLYQCARKYDQIVNQETEKFSSFFFRFDELVEMMTARARPPKRRRISSSSSKETNKAAVAEISPCEDDNDGKVFVETITKFLQELSDDQPA
AETDSSSASRDSPE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019938 0 1
AT3G05260 NAD(P)-binding Rossmann-fold s... Lus10021931 1.7 0.7300
Lus10003442 3.5 0.7159
AT3G49700 AtACS9, ACS9, E... ETHYLENE OVERPRODUCING 3, 1-am... Lus10007249 5.1 0.7657
AT5G66430 S-adenosyl-L-methionine-depend... Lus10024671 7.5 0.7217
AT1G80930 MIF4G domain-containing protei... Lus10011226 15.7 0.7103
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10026419 17.9 0.6902
AT3G01140 MYB NOK, ATMYB106 NOECK, myb domain protein 106 ... Lus10030442 18.7 0.6760
Lus10032314 19.2 0.6978
Lus10005511 21.2 0.6233
AT1G33540 SCPL18 serine carboxypeptidase-like 1... Lus10011710 22.4 0.6892

Lus10019938 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.