Lus10019939 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42300 141 / 4e-46 UBL5 ubiquitin-like protein 5 (.1)
AT3G45180 139 / 5e-45 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023188 144 / 2e-47 AT5G42300 140 / 1e-45 ubiquitin-like protein 5 (.1)
Lus10002228 144 / 2e-47 AT5G42300 140 / 1e-45 ubiquitin-like protein 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G223100 144 / 3e-47 AT5G42300 144 / 2e-47 ubiquitin-like protein 5 (.1)
Potri.008G039100 142 / 2e-46 AT5G42300 147 / 2e-48 ubiquitin-like protein 5 (.1)
Potri.004G211600 142 / 3e-46 AT3G45180 143 / 1e-46 Ubiquitin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
Representative CDS sequence
>Lus10019939 pacid=23163965 polypeptide=Lus10019939 locus=Lus10019939.g ID=Lus10019939.BGIv1.0 annot-version=v1.0
ATGTTGGAAGTAGTGTTGAACGATAGGCTGGGGAAGAAGGTGAAGGTGAAGTGCAACGAGGATGACACAATCGGCGACCTGAAGAAACTGGTGGCGGCGC
AGACCGGAACGAGGGCGGAGAAGATAAGGATTCAAAAGTGGTACACCATCTACAAGGACCACATCACCCTCGCCGACTACGAGATTCACGACGGGATGGG
CCTCGAGCTTTACTACAATTGA
AA sequence
>Lus10019939 pacid=23163965 polypeptide=Lus10019939 locus=Lus10019939.g ID=Lus10019939.BGIv1.0 annot-version=v1.0
MLEVVLNDRLGKKVKVKCNEDDTIGDLKKLVAAQTGTRAEKIRIQKWYTIYKDHITLADYEIHDGMGLELYYN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Lus10019939 0 1
AT3G32930 unknown protein Lus10013750 3.5 0.6856
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10027836 5.5 0.6061
AT2G01770 ATVIT1, VIT1 vacuolar iron transporter 1 (.... Lus10034583 10.9 0.7093
AT3G18110 EMB1270 embryo defective 1270, Pentatr... Lus10013785 12.8 0.6830
AT4G10265 Wound-responsive family protei... Lus10039760 15.9 0.6513
AT3G12260 LYR family of Fe/S cluster bio... Lus10008661 17.3 0.6536
AT2G32720 B5 #4, B5#4, AT... ARABIDOPSIS CYTOCHROME B5 ISOF... Lus10043137 17.3 0.6453
AT3G48890 MSBP2, ATMP2, A... MEMBRANE STEROID BINDING PROTE... Lus10038868 20.4 0.6521
AT5G27440 unknown protein Lus10041604 25.1 0.6583
AT4G23330 unknown protein Lus10024630 36.1 0.6112

Lus10019939 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.