Lus10019958 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24330 87 / 3e-20 Protein of unknown function (DUF1682) (.1)
AT5G49945 81 / 5e-18 Protein of unknown function (DUF1682) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G223000 98 / 4e-24 AT4G24330 479 / 8e-167 Protein of unknown function (DUF1682) (.1)
PFAM info
Representative CDS sequence
>Lus10019958 pacid=23156199 polypeptide=Lus10019958 locus=Lus10019958.g ID=Lus10019958.BGIv1.0 annot-version=v1.0
ATGGTCAGACCTATCTCCCTCCTCGCTTTCCTCTCCCTGCTATCCCTCGTCTCCTTCCTCCTCCTCCTTCAATCTCCCTCCCCCGCTGTCGCCGATTCCC
AATTTGAAGGCTTCGACGCCGATGATGACGATGCCATCGAGGAGCCTCTCGATCCTTCCTCTTTCGAGCTCAACGATCTCCCTTTGACCCAGACCGAATC
CCTATCCACCTCAGATCCCAATCCTTCCTCAGCTTCCGATCACCCCAATTCCAAACCTGCTTCTACTGAATCTGATGTTTCCAAATCCAAACCCGATTCT
CCATCTACTAAAACTTCCAGCTTGGATTACTGGGACGAAGACGAGTTCGAAGGTCTCCCAACTCAGCCTGAAAAACCAGATGTTGATAATACTCCAGTCA
CTCCCTCAACTGCTGAAGGAAGTAAAACATCAGATCCGAATTCGAAGGAGGCTGGCGAGGGTCTTCCCAAGAGGAAGCAATCATTCACCGTGGAGATTGT
GTGCGTCTCGTTCTTGATTATGTTCGTTATTAACTACTTCACCGGGAAGCGAGAGATTTGA
AA sequence
>Lus10019958 pacid=23156199 polypeptide=Lus10019958 locus=Lus10019958.g ID=Lus10019958.BGIv1.0 annot-version=v1.0
MVRPISLLAFLSLLSLVSFLLLLQSPSPAVADSQFEGFDADDDDAIEEPLDPSSFELNDLPLTQTESLSTSDPNPSSASDHPNSKPASTESDVSKSKPDS
PSTKTSSLDYWDEDEFEGLPTQPEKPDVDNTPVTPSTAEGSKTSDPNSKEAGEGLPKRKQSFTVEIVCVSFLIMFVINYFTGKREI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G24330 Protein of unknown function (D... Lus10019958 0 1
Lus10019304 5.6 0.8708
AT1G08500 AtENODL18 early nodulin-like protein 18 ... Lus10037998 9.0 0.7972
AT1G20330 FRL1, CVP1, SMT... FRILL1, COTYLEDON VASCULAR PAT... Lus10023995 10.4 0.8292
AT1G35780 unknown protein Lus10020921 11.5 0.8169
AT2G29390 ATSMO2-2, SMO2-... Arabidopsis thaliana sterol 4-... Lus10040739 18.6 0.8113
AT4G36750 Quinone reductase family prote... Lus10040486 24.5 0.8018
AT5G07900 Mitochondrial transcription te... Lus10040819 27.1 0.7871
AT3G63470 SCPL40 serine carboxypeptidase-like 4... Lus10005327 29.1 0.8084
AT4G18760 AtRLP51 receptor like protein 51 (.1) Lus10015226 32.1 0.7800
AT4G30390 unknown protein Lus10020378 33.5 0.7661

Lus10019958 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.