Lus10019961 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G23945 89 / 2e-21 Eukaryotic aspartyl protease family protein (.1)
AT4G30030 84 / 8e-20 Eukaryotic aspartyl protease family protein (.1)
AT4G30040 74 / 5e-16 Eukaryotic aspartyl protease family protein (.1)
AT4G12920 54 / 5e-09 UND UNDEAD, Eukaryotic aspartyl protease family protein (.1)
AT2G28030 43 / 2e-05 Eukaryotic aspartyl protease family protein (.1)
AT2G28040 42 / 7e-05 Eukaryotic aspartyl protease family protein (.1)
AT3G50050 42 / 8e-05 Eukaryotic aspartyl protease family protein (.1)
AT2G17760 40 / 0.0003 Eukaryotic aspartyl protease family protein (.1)
AT2G28010 39 / 0.0007 Eukaryotic aspartyl protease family protein (.1)
AT3G25700 39 / 0.0008 Eukaryotic aspartyl protease family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015486 265 / 2e-87 AT2G23945 248 / 3e-76 Eukaryotic aspartyl protease family protein (.1)
Lus10023451 134 / 3e-38 AT2G23945 232 / 2e-71 Eukaryotic aspartyl protease family protein (.1)
Lus10002275 130 / 1e-36 AT2G23945 164 / 7e-46 Eukaryotic aspartyl protease family protein (.1)
Lus10004064 128 / 5e-35 AT4G30040 156 / 3e-41 Eukaryotic aspartyl protease family protein (.1)
Lus10002276 119 / 2e-32 AT2G23945 206 / 2e-61 Eukaryotic aspartyl protease family protein (.1)
Lus10031450 116 / 2e-31 AT4G30030 231 / 2e-71 Eukaryotic aspartyl protease family protein (.1)
Lus10031449 115 / 6e-31 AT2G23945 219 / 3e-66 Eukaryotic aspartyl protease family protein (.1)
Lus10011615 115 / 6e-31 AT2G23945 224 / 5e-68 Eukaryotic aspartyl protease family protein (.1)
Lus10019960 87 / 9e-21 AT2G23945 256 / 5e-81 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G179500 92 / 2e-22 AT2G23945 412 / 3e-141 Eukaryotic aspartyl protease family protein (.1)
Potri.018G106500 61 / 1e-11 AT4G30030 150 / 2e-41 Eukaryotic aspartyl protease family protein (.1)
Potri.019G002100 46 / 2e-06 AT2G03200 529 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.014G114400 40 / 0.0002 AT5G33340 475 / 1e-166 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Potri.006G232600 39 / 0.0005 AT5G10770 438 / 1e-150 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence
>Lus10019961 pacid=23156147 polypeptide=Lus10019961 locus=Lus10019961.g ID=Lus10019961.BGIv1.0 annot-version=v1.0
ATGTTCAAGGTAGAATACGCCGGTGGACAGAGTTCGGAAGGAGTCTACGCCACCGAACAACTAACCTTTCGAACCTCCGACGACGGGACAATCACTGTCC
CGAAACTTCTATTTGGCTGCACTATTCTGGAGACTGGGACCAACGATCTCGATCCACGAGTCAACGGGATACTAGGATTGGGTACATGGGTTCCTGGTAT
GCCGCGAGGAGCAAAATCCTTGGTGAACCAATTGGGGGCCAAATTCTCGTATTGTGTCGGTAGCTTATCCGACATTACATACCCTTATAACCAATTATCT
TTCGGTGATGCTGTTGATTTAGCCGGCGACCAAACTCCGTTCTACTTCAGAGAAGGCAATTACTACATGCACCTCGTGAATATCAACTTAGGAGGACTAG
TATTATTTACTTATGCTGTAGTATCAAATATTTTCTTCTAA
AA sequence
>Lus10019961 pacid=23156147 polypeptide=Lus10019961 locus=Lus10019961.g ID=Lus10019961.BGIv1.0 annot-version=v1.0
MFKVEYAGGQSSEGVYATEQLTFRTSDDGTITVPKLLFGCTILETGTNDLDPRVNGILGLGTWVPGMPRGAKSLVNQLGAKFSYCVGSLSDITYPYNQLS
FGDAVDLAGDQTPFYFREGNYYMHLVNINLGGLVLFTYAVVSNIFF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G23945 Eukaryotic aspartyl protease f... Lus10019961 0 1
AT5G04885 Glycosyl hydrolase family prot... Lus10005706 1.0 0.8758
Lus10001379 1.4 0.8704
AT5G55690 MADS MADS-box transcription factor ... Lus10019819 2.0 0.7349
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Lus10024816 8.3 0.7381
AT3G15510 NAC ATNAC2, ANAC056... NAC-REGULATED SEED MORPHOLOGY ... Lus10007410 8.9 0.7276
AT3G17152 Plant invertase/pectin methyle... Lus10017077 12.0 0.6942
AT5G67360 ARA12 Subtilase family protein (.1) Lus10008919 14.5 0.7003
AT2G26490 Transducin/WD40 repeat-like su... Lus10016289 15.7 0.7003
AT5G09360 LAC14 laccase 14 (.1) Lus10036070 16.7 0.7003
AT2G18470 AtPERK4, PERK4 proline-rich extensin-like rec... Lus10026027 17.0 0.6664

Lus10019961 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.