Lus10019978 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30380 156 / 3e-50 EXLB2 Barwin-related endoglucanase (.1)
AT2G18660 83 / 2e-21 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT2G45110 59 / 4e-11 ATHEXPBETA1.1, ATEXPB4 expansin B4 (.1)
AT1G65681 56 / 4e-10 EXPB6 beta expansin 6 (.1)
AT2G40610 47 / 4e-07 ATHEXPALPHA1.11, ATEXP8, ATEXPA8 expansin A8 (.1)
AT3G45970 47 / 4e-07 ATHEXPBETA2.1, ATEXPL1, ATEXLA1 EXPANSIN L1, expansin-like A1 (.1)
AT3G60570 47 / 6e-07 ATHEXPBETA1.3, ATEXPB5 expansin B5 (.1)
AT3G45960 46 / 1e-06 ATHEXPBETA2.3, ATEXPL3, ATEXLA3 expansin-like A3 (.1.2)
AT1G12560 46 / 2e-06 ATHEXPALPHA1.26, ATEXP7, ATEXPA7 expansin A7 (.1)
AT1G65680 45 / 3e-06 ATHEXPBETA1.4, ATEXPB2 expansin B2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031759 97 / 3e-26 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1)
Lus10042435 89 / 2e-23 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10026232 84 / 4e-21 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10020130 82 / 3e-20 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10026930 75 / 3e-17 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10031760 65 / 1e-14 AT4G30380 72 / 1e-17 Barwin-related endoglucanase (.1)
Lus10026931 66 / 7e-14 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Lus10030078 62 / 7e-13 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1)
Lus10013118 61 / 2e-12 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G176300 159 / 1e-51 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.018G098200 119 / 9e-36 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.018G101600 104 / 7e-30 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G179300 103 / 2e-29 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.003G218300 96 / 4e-26 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.018G029100 69 / 8e-16 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G252200 67 / 5e-15 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.006G249500 64 / 9e-14 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.018G031901 63 / 1e-13 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G155000 54 / 9e-10 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10019978 pacid=23156160 polypeptide=Lus10019978 locus=Lus10019978.g ID=Lus10019978.BGIv1.0 annot-version=v1.0
ATGGAGAGAACCTCTATGATGATGATGATGATCATGATGGCCATGGCTGCCACACTTGCTTCAATAGCCACAGCAAATCCTGGCATTGCCACTTTCTACA
CTAGTTACACCCCATCCGCGTGCTTTGGCAACCAAGATAAGGGAGTATGGATCGCGGCCGCGGGTCCAGCCCTATGGAACAATGGAGCTGTGTGTGGGAA
AAAATTCCGAGTCAAATGCACGGGTCCACGGAACCCCGTACCCCATCCTTGTACGGGAAAGGAAGTTGTGGTCACGATTACGGATCATTGTCCCGGAGGG
TGTCCTTCGACGCTCGATCTTTCGAGGGAAGCTTTTGCAACCATTGCCAACCCTGTAGCAGGGATCATCAACATTGAGTACACTCCGGACTTCCTATAA
AA sequence
>Lus10019978 pacid=23156160 polypeptide=Lus10019978 locus=Lus10019978.g ID=Lus10019978.BGIv1.0 annot-version=v1.0
MERTSMMMMMIMMAMAATLASIATANPGIATFYTSYTPSACFGNQDKGVWIAAAGPALWNNGAVCGKKFRVKCTGPRNPVPHPCTGKEVVVTITDHCPGG
CPSTLDLSREAFATIANPVAGIINIEYTPDFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10019978 0 1
AT1G27040 Major facilitator superfamily ... Lus10006477 12.8 0.8862
AT4G12300 CYP706A4 "cytochrome P450, family 706, ... Lus10035196 26.1 0.8720
AT5G18350 Disease resistance protein (TI... Lus10018024 27.9 0.8750
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Lus10025838 36.9 0.8745
AT4G16640 Matrixin family protein (.1) Lus10028955 52.4 0.8578
Lus10031026 63.0 0.8562
AT5G19530 ACL5 ACAULIS 5, S-adenosyl-L-methio... Lus10000469 64.3 0.8469
AT3G47570 Leucine-rich repeat protein ki... Lus10031043 64.3 0.7945
AT5G10530 Concanavalin A-like lectin pro... Lus10029555 71.1 0.8400
AT1G11040 HSP40/DnaJ peptide-binding pro... Lus10029685 75.8 0.8506

Lus10019978 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.