Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30320 182 / 1e-58 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 177 / 4e-56 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 173 / 2e-54 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 150 / 1e-45 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 147 / 3e-45 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 145 / 3e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14610 136 / 8e-41 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT4G33720 136 / 1e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G09590 135 / 5e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14580 128 / 9e-38 ATPRB1 basic pathogenesis-related protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015522 [exp] 288 / 4e-100 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10001319 [exp] 208 / 5e-69 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 208 / 1e-68 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 150 / 9e-46 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10005557 [exp] 148 / 5e-45 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006981 [exp] 135 / 6e-40 AT4G25780 235 / 2e-79 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10011318 [exp] 133 / 4e-39 AT4G31470 164 / 1e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020491 [exp] 131 / 8e-39 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 128 / 2e-37 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G096007 [exp] 191 / 2e-62 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 189 / 3e-61 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G007000 [exp] 146 / 2e-44 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288600 [exp] 137 / 3e-41 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1) Potri.009G083100 [exp] 135 / 2e-40 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 134 / 5e-40 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083600 [exp] 131 / 7e-39 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083000 [exp] 128 / 1e-37 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096028 [exp] 129 / 4e-37 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 118 / 3e-33 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10019993 pacid=23156168 polypeptide=Lus10019993 locus=Lus10019993.g ID=Lus10019993.BGIv1.0 annot-version=v1.0 ATGAGTCTATCGTCGAGTATTACCATGGCGTCAAGGTTGCTGACCCCTTTAGATGTTAATCAATTAGCCAGCCGGCGTCCACTCGCCACAACCATACTCA TCATAATCCCTCTCCTAGTCCTTTTCCTCCTCGACACCGCGGCATTCGCTCATGGAGCCACCACCTCCACAAAACCACCAAAAAGTAGGGCATATGCCAA TGCAATCGCCCAATTCATGAGACCGCAAAATGCTGTCAGGGTAGCATTGAAGCTGCCCCCGTTACGTTGGGACGAGAGACTGGCACGATACGCGACGTGG TATGCGAACCAAAGGAGGGTGGATTGTGCCATGGTGCACTCGAACGGTCCCTACGGGGAGAATATATTTTGGGGGAGCGGAAATGGAGCAGGGTGGACTC CGGCCCATGCTGTATCAGCATGGATTGGAGAGAGAAAGTCGTATAGCTATTGGTCCAACTCGTGTGGTGGAGGGAACGAGGGGTGTGGACATTACACGCA GATAGTGTGGAGGAGTACGGTTCGAGTTGGGTGTGCCCGGGTTGTTTGTAACGGTGGGAAGGGGGTGTTCATGAGTTGTAACTATGACCCGCCTGGAAAC TACGTTGGGGAGAGACCTTATTGA
AA sequence Show only first row Show all	>Lus10019993 pacid=23156168 polypeptide=Lus10019993 locus=Lus10019993.g ID=Lus10019993.BGIv1.0 annot-version=v1.0 MSLSSSITMASRLLTPLDVNQLASRRPLATTILIIIPLLVLFLLDTAAFAHGATTSTKPPKSRAYANAIAQFMRPQNAVRVALKLPPLRWDERLARYATW YANQRRVDCAMVHSNGPYGENIFWGSGNGAGWTPAHAVSAWIGERKSYSYWSNSCGGGNEGCGHYTQIVWRSTVRVGCARVVCNGGKGVFMSCNYDPPGN YVGERPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30320			CAP (Cysteine-rich secretory p...		Lus10019993 [exp]	0	1
AT1G12560		ATHEXPALPHA1.26...	expansin A7 (.1)		Lus10006711 [exp]	2.0	0.9473
AT4G02270		RHS13	root hair specific 13 (.1)		Lus10013419 [exp]	4.2	0.9047
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10028896 [exp]	5.3	0.8547
AT5G05500		MOP10	Pollen Ole e 1 allergen and ex...		Lus10009837 [exp]	5.5	0.9042
AT1G48130		ATPER1	1-cysteine peroxiredoxin 1 (.1...		Lus10018342 [exp]	6.2	0.8172
AT1G63450		RHS8	root hair specific 8 (.1)		Lus10000604 [exp]	6.6	0.9001
AT1G48930		ATGH9C1	glycosyl hydrolase 9C1 (.1)		Lus10017402 [exp]	6.7	0.8918
AT3G14820			GDSL-like Lipase/Acylhydrolase...		Lus10028424 [exp]	7.4	0.8226
AT5G05500		MOP10	Pollen Ole e 1 allergen and ex...		Lus10040948 [exp]	9.2	0.8773
					Lus10013951 [exp]	9.4	0.7343

Compare expression of checked genes

Lus10019993 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.