Lus10020000 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30270 342 / 2e-119 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57550 337 / 3e-117 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G25810 335 / 3e-116 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57560 334 / 4e-116 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT2G18800 335 / 5e-116 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT5G48070 320 / 2e-110 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
AT4G14130 315 / 4e-108 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57530 310 / 2e-106 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT1G65310 308 / 1e-105 XTH17, XTR1, ATXTH17 xyloglucan endotransglucosylase/hydrolase 17 (.1)
AT5G57540 307 / 2e-105 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015529 508 / 0 AT4G30270 346 / 6e-119 SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
Lus10000678 328 / 2e-113 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10021638 325 / 3e-112 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10028947 316 / 1e-108 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10020773 315 / 2e-108 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10030484 315 / 2e-108 AT4G25810 398 / 9e-141 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Lus10020772 313 / 9e-108 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 313 / 9e-108 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10008522 304 / 7e-104 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G094900 342 / 5e-119 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 337 / 3e-117 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 335 / 3e-116 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G005700 333 / 1e-114 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G094800 329 / 8e-114 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.005G007200 318 / 1e-109 AT4G25810 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.005G201200 315 / 5e-108 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 314 / 7e-108 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 313 / 7e-108 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 311 / 9e-107 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10020000 pacid=23156167 polypeptide=Lus10020000 locus=Lus10020000.g ID=Lus10020000.BGIv1.0 annot-version=v1.0
ATGGCAACCTCATCCTCCTTGTTCCTAGTGTTAGTGTTGGCATCCATCATGGTAGGTCTCTCATTTGCGAGTAACTTCCAAGATGACATCGCCGTGACAT
TCGGAGACGGCCGTGTCAGAATCCAAGACAGCGGCAACCTTATGAGTCTCTCCCTCGACAACTCTTCAGGCTCGGGGTTTCAGTCCAAAGCTGACTTCCT
CTACGCCAAAGTCGACATGAAGATTAAACTCGTCCCCGGTAACTCTGCTGGCACTGTCACTTCTTTCTACTTAAAATCACAAGGGACGACATGGGACGAG
ATAGACATGGAATTCCTAGGCAACACAAGCGGCGACCCATACGTCCTCCACACGAACATCTTCGTGAACGGCAACGGCAAGAGAGAACAACAATTCAACC
TCTGGTTCGACCCGACAACCGATTTCCACTCCTACTCAATCATATGGAACCCTTCCCACATAGTCCTCGTAGTGGACGACAAGCCCCTCAGGGAGTACCG
AAACCTCCAGCCCATGAACGTTCCCTACCCAACGACCCAGCCAATGAAGCTTTACGGGTCCATCTGGAACGCCGATGATTGGGCCACCCGTGGCGGACGG
GTCAAGACCGATTGGTCCAAGGCCCCTTTCACCGCCTCCTTCAGTGACTACAACGCCGATGGTGATAAAAACTCCCCGTGGTACTCTGTGGAGAGGCTTG
ACGGCGACGCCGTGAAACAGATGGAGTGGGTTCAGAAGAATTACATGGTGTACAACTACTGTTCTGATCCTAGTCGGTTCCCTGGCGGGTTGCCGGCGGA
ATGTAACGTCGGCAAAAACTAA
AA sequence
>Lus10020000 pacid=23156167 polypeptide=Lus10020000 locus=Lus10020000.g ID=Lus10020000.BGIv1.0 annot-version=v1.0
MATSSSLFLVLVLASIMVGLSFASNFQDDIAVTFGDGRVRIQDSGNLMSLSLDNSSGSGFQSKADFLYAKVDMKIKLVPGNSAGTVTSFYLKSQGTTWDE
IDMEFLGNTSGDPYVLHTNIFVNGNGKREQQFNLWFDPTTDFHSYSIIWNPSHIVLVVDDKPLREYRNLQPMNVPYPTTQPMKLYGSIWNADDWATRGGR
VKTDWSKAPFTASFSDYNADGDKNSPWYSVERLDGDAVKQMEWVQKNYMVYNYCSDPSRFPGGLPAECNVGKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30270 XTH24, SEN4, BR... SENESCENCE 4, meristem-5, MERI... Lus10020000 0 1

Lus10020000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.