Lus10020005 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G57280 296 / 4e-101 RID2 root initiation defective 2, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028960 419 / 9e-150 AT5G57280 444 / 4e-159 root initiation defective 2, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10007484 402 / 4e-143 AT5G57280 436 / 9e-156 root initiation defective 2, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10015533 96 / 5e-25 AT5G57280 46 / 1e-06 root initiation defective 2, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10040430 43 / 0.0002 AT1G36310 443 / 3e-156 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G338700 337 / 2e-117 AT5G57280 370 / 1e-129 root initiation defective 2, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.018G049800 317 / 2e-109 AT5G57280 355 / 5e-124 root initiation defective 2, S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF08241 Methyltransf_11 Methyltransferase domain
CL0063 PF12589 WBS_methylT Methyltransferase involved in Williams-Beuren syndrome
Representative CDS sequence
>Lus10020005 pacid=23156188 polypeptide=Lus10020005 locus=Lus10020005.g ID=Lus10020005.BGIv1.0 annot-version=v1.0
ATGGCAACTCGCCCAGAAAATCTAGCGCCGCCTGAAATTTTCTACAACGATACAGAAGCTCGTAAATACACTTCATCTTCCCGAATTATCAAAATTCAGT
CGCAGCTTTCCGAGAGAGCATTGGAACTTCTGGCTTTGCCTGATGATGGCGTCCCCAGATTGCTTCTCGATATTGGCTGCGGATCAGGGCTTAGTGGGGA
GACATTGACTGAAAATTGCCATGAATGGATTGGTCTGGACATTTCAGAATCAATGCTAGATATTGCAGTGGAGCGAGAAGTTGATGGGGATCTTATGCTA
CATGACATGGGTCAGGGCTTGCCATTTAGGCCTGGAACTATTGATGGTGCCATTAGCATCTCTGCTGTTCAGCGTGAGTTGATTCTGAGAGCAGCAATGC
AAGCTGGGTTTGCTGGTGGAGTGGTTGTTGACTACCCACACAGTACCAAGAGCAGAAAGGAGTACTTGGTCCTCACTTGCGGACCAGCATCAATCGATGC
AGCCGTTCCCAGACCAAAAGGTCTAGACGGCTACGAAAGCTGCTCTGAAGACGAAAGTGGTGATGCCTATGATGAAGAAAAGCAAACAGTTAGCATATCA
GATAGACACAGACCAAAGAAAAGGCAAAAAGCAGGGAAGAAAGGGAAAGGGAAGCAATGGTTATTGAAGAAAAAGGAGCAGATGAGGGGTAAGGGATTTG
AAGTCCCACCTGATACAAGATATACTGGCAGGAAACGCAAGGCAAAGTTTTGA
AA sequence
>Lus10020005 pacid=23156188 polypeptide=Lus10020005 locus=Lus10020005.g ID=Lus10020005.BGIv1.0 annot-version=v1.0
MATRPENLAPPEIFYNDTEARKYTSSSRIIKIQSQLSERALELLALPDDGVPRLLLDIGCGSGLSGETLTENCHEWIGLDISESMLDIAVEREVDGDLML
HDMGQGLPFRPGTIDGAISISAVQRELILRAAMQAGFAGGVVVDYPHSTKSRKEYLVLTCGPASIDAAVPRPKGLDGYESCSEDESGDAYDEEKQTVSIS
DRHRPKKRQKAGKKGKGKQWLLKKKEQMRGKGFEVPPDTRYTGRKRKAKF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G57280 RID2 root initiation defective 2, S... Lus10020005 0 1
AT3G52570 alpha/beta-Hydrolases superfam... Lus10014222 3.2 0.8194
AT4G34940 ARO1 armadillo repeat only 1 (.1) Lus10034486 8.1 0.7571
AT2G37300 ABCI16 ATP-binding cassette I16, unkn... Lus10025272 14.3 0.8093
AT4G11720 HAP2, GCS1 GENERATIVE CELL-SPECIFIC 1, ha... Lus10024496 22.9 0.7906
AT3G07140 GPI transamidase component Gpi... Lus10025918 24.3 0.8094
AT4G24880 unknown protein Lus10007295 33.3 0.7722
AT2G01820 CYCJ18 Leucine-rich repeat protein ki... Lus10001851 38.9 0.7849
AT5G40480 EMB3012 embryo defective 3012 (.1) Lus10002516 43.0 0.7408
AT1G09870 histidine acid phosphatase fam... Lus10040951 50.3 0.7618
AT5G58160 actin binding (.1) Lus10024450 52.2 0.7439

Lus10020005 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.