Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G04470 230 / 1e-77 PMP22 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G14305 229 / 3e-77 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT5G19750 66 / 3e-13 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT5G43140 64 / 3e-12 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT3G24570 53 / 1e-08 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT2G14860 43 / 6e-05 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G33905 41 / 0.0001 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011798 [exp] 208 / 4e-69 AT4G14305 262 / 1e-90 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10034922 [exp] 66 / 2e-13 AT3G24570 330 / 4e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10012098 [exp] 67 / 3e-13 AT5G19750 259 / 4e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10023648 [exp] 66 / 3e-13 AT3G24570 330 / 6e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10010446 [exp] 65 / 8e-13 AT5G19750 258 / 2e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10038626 [exp] 60 / 4e-11 AT3G24570 273 / 1e-93 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10039003 [exp] 60 / 7e-11 AT5G19750 241 / 1e-79 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10018700 [exp] 59 / 1e-10 AT5G43140 253 / 2e-83 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10011679 [exp] 58 / 2e-10 AT3G24570 249 / 2e-84 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G007100 [exp] 265 / 2e-91 AT4G04470 230 / 1e-77 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.004G008700 [exp] 263 / 1e-90 AT4G04470 209 / 2e-69 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.010G068900 [exp] 186 / 2e-60 AT4G14305 252 / 1e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.004G009201 [exp] 90 / 8e-24 AT4G14305 72 / 2e-17 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.016G029700 [exp] 71 / 7e-15 AT5G19750 257 / 5e-85 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.006G032500 [exp] 71 / 1e-14 AT5G19750 279 / 8e-94 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.018G081600 [exp] 62 / 6e-12 AT3G24570 309 / 7e-108 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.018G037100 [exp] 58 / 2e-10 AT3G24570 289 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.009G090600 [exp] 43 / 3e-05 AT4G33905 299 / 1e-102 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.001G296400 [exp] 42 / 0.0001 AT2G14860 300 / 6e-103 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04117 [flax] [poplar] Mpv17_PMP22 Mpv17 / PMP22 family
Representative CDS sequence Show only first row Show all	>Lus10020027 pacid=23156247 polypeptide=Lus10020027 locus=Lus10020027.g ID=Lus10020027.BGIv1.0 annot-version=v1.0 ATGAGTTCTGGGGCGAAGAAAGGTCTGCAACAATACGTACTCCAGCTCCAGCAACATCCTTTGAGAACTAAGGCAATCACTGCAGCTGCTCTCTCTGCTG TCAGCGATATAGTGGCGCAGAAGCTTTCTGGAATTCCGAAGCTCCAACTCAAACGACTTCTTCTCAAAGTGATATTCGGGTTTGCGTATCTGGGTCCATT TGGGCATTTCCTGCACATAGTCCTGGACAAGATCTTCAAGGGAAAGAAGGACACTAAAACAGTTGCCAAGAAGGTGGTTGTGGAGCAGTTGACATCTTCC CCATGGAATAACTTGATGTTCATGATCTACTACGGCTTGGTTATCGAAGGGAGACCCTGGATGCATGTGAAATCCAAAATCAAGCAAGACTACCCAAAAG TGCAATTCACTTCATGGACGTTCTGGCCAGTAGTGGGGTGGATAAATCACCAGTATGTGCCTCTGCAGTTCCGTGTCATTTTCCACAGTGTGGTTGCTTG TTTCTGGGGAATATTTCTGAACCTGCGAGCCAAGTCTATAGCATTGGCTAAAGACTAG
AA sequence Show only first row Show all	>Lus10020027 pacid=23156247 polypeptide=Lus10020027 locus=Lus10020027.g ID=Lus10020027.BGIv1.0 annot-version=v1.0 MSSGAKKGLQQYVLQLQQHPLRTKAITAAALSAVSDIVAQKLSGIPKLQLKRLLLKVIFGFAYLGPFGHFLHIVLDKIFKGKKDTKTVAKKVVVEQLTSS PWNNLMFMIYYGLVIEGRPWMHVKSKIKQDYPKVQFTSWTFWPVVGWINHQYVPLQFRVIFHSVVACFWGIFLNLRAKSIALAKD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G04470		PMP22	Peroxisomal membrane 22 kDa (M...		Lus10020027 [exp]	0	1
AT1G07570		APK1A	Protein kinase superfamily pro...		Lus10000954 [exp]	1.0	0.9299
AT3G28050			nodulin MtN21 /EamA-like trans...		Lus10039428 [exp]	3.5	0.9160
AT4G19540		INDH, INDL	IND1(iron-sulfur protein requi...		Lus10018779 [exp]	4.2	0.9104
AT5G03905			Iron-sulphur cluster biosynthe...		Lus10014201 [exp]	4.5	0.9035
AT3G61113			Ubiquitin related modifier 1 (...		Lus10041378 [exp]	4.6	0.9178
AT1G67850			Protein of unknown function (D...		Lus10006472 [exp]	4.9	0.8972
AT1G78070			Transducin/WD40 repeat-like su...		Lus10041102 [exp]	5.7	0.9109
AT5G01260			Carbohydrate-binding-like fold...		Lus10002495 [exp]	6.3	0.9199
AT4G03020			transducin family protein / WD...		Lus10042682 [exp]	7.9	0.9112
AT3G24490	Trihelix		Alcohol dehydrogenase transcri...		Lus10035893 [exp]	8.2	0.9052

Compare expression of checked genes

Lus10020027 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.