Lus10020064 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05260 199 / 1e-62 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
AT3G01190 197 / 3e-62 Peroxidase superfamily protein (.1)
AT5G15180 195 / 4e-61 Peroxidase superfamily protein (.1)
AT3G21770 192 / 5e-60 Peroxidase superfamily protein (.1)
AT4G11290 191 / 1e-59 Peroxidase superfamily protein (.1)
AT1G05250 164 / 4e-49 Peroxidase superfamily protein (.1)
AT1G05240 164 / 4e-49 Peroxidase superfamily protein (.1)
AT5G51890 157 / 2e-46 Peroxidase superfamily protein (.1)
AT2G39040 149 / 5e-43 Peroxidase superfamily protein (.1)
AT5G42180 147 / 5e-43 PER64 peroxidase 64, Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006756 298 / 7e-102 AT3G01190 379 / 3e-132 Peroxidase superfamily protein (.1)
Lus10018374 236 / 3e-77 AT3G01190 414 / 4e-146 Peroxidase superfamily protein (.1)
Lus10007638 229 / 1e-74 AT3G01190 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10027163 204 / 1e-64 AT4G11290 491 / 4e-176 Peroxidase superfamily protein (.1)
Lus10039681 203 / 2e-64 AT4G11290 488 / 3e-175 Peroxidase superfamily protein (.1)
Lus10027164 194 / 8e-61 AT1G05260 463 / 3e-165 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10039680 187 / 3e-58 AT1G05260 458 / 3e-163 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10031548 187 / 4e-58 AT1G05260 441 / 1e-156 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10015127 185 / 2e-57 AT1G05260 444 / 7e-158 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G023200 211 / 2e-67 AT3G01190 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.017G038100 211 / 2e-67 AT1G05260 479 / 7e-172 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Potri.011G027300 211 / 2e-67 AT3G01190 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.019G063201 211 / 2e-67 AT3G01190 412 / 4e-145 Peroxidase superfamily protein (.1)
Potri.004G023100 209 / 1e-66 AT3G01190 403 / 1e-141 Peroxidase superfamily protein (.1)
Potri.007G122100 207 / 6e-66 AT1G05260 496 / 3e-178 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Potri.017G037900 200 / 4e-63 AT1G05260 481 / 2e-172 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Potri.007G122200 199 / 5e-63 AT5G15180 395 / 2e-138 Peroxidase superfamily protein (.1)
Potri.007G122351 198 / 2e-62 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122401 198 / 2e-62 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10020064 pacid=23156235 polypeptide=Lus10020064 locus=Lus10020064.g ID=Lus10020064.BGIv1.0 annot-version=v1.0
ATGGCTGCTTCAAAGGGCTTGTGGCCTCTGTTACTCCTCCAAATTTGCTTCACCTTTACGTCCGCCAACCCACGACAGCTGAAAGTGGGCTACTACGCAA
GAACATTCCCAAATGCTGAGAGGCAATCGGCGGTCCTTTGCCTCAGGATGTACTTCCATGATTGCTTCATCAGGGGTTGTGATGCTTCAGTTTTGATAGA
TTCGACAAAAGACCGCCGATCTGAAAAGGATGCCTTCGCGAATCTCAGCCTCGGAGGGTTTGGAGTCATCGACCGAGTAAAGGCATCCCTTGAGATGGAG
TGTCCAGGCATCGTCTCGTGCTCAGATATCCTAGCCATTGTAGCTAGAGATGTTACGGTCGCGGTATACGAAAGGGCTACGATGGGAAGTGGAGAGAAGG
ATATCCATAATGGACGAGGCGCTATTCGGCCATATCCCACAGTCGGCGAATATCTCCTTCTTGACCTCACGCTTCAATGTCGGGCTTTCGATCAAGGACT
TTCGATCAAGGACTTGGTTGTGCTACAAGGAAGCCACACCATAGGAATCTCCCATTGCTCTTCCTTCACCAGCAGAATCTACAACTTCTCAGAAAGCAGC
GACGTGGACCCTACCCTGGACTCGGAGTATGTACCCAATCTGAGACGGAAATGTAGAACGGCGACGGATCAGACGAAGGTGGTGGAAATGGACCCCGGAA
GCCTCAAGACATTTTGA
AA sequence
>Lus10020064 pacid=23156235 polypeptide=Lus10020064 locus=Lus10020064.g ID=Lus10020064.BGIv1.0 annot-version=v1.0
MAASKGLWPLLLLQICFTFTSANPRQLKVGYYARTFPNAERQSAVLCLRMYFHDCFIRGCDASVLIDSTKDRRSEKDAFANLSLGGFGVIDRVKASLEME
CPGIVSCSDILAIVARDVTVAVYERATMGSGEKDIHNGRGAIRPYPTVGEYLLLDLTLQCRAFDQGLSIKDLVVLQGSHTIGISHCSSFTSRIYNFSESS
DVDPTLDSEYVPNLRRKCRTATDQTKVVEMDPGSLKTF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05260 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Pe... Lus10020064 0 1
AT1G69630 F-box/RNI-like superfamily pro... Lus10011409 2.6 0.7269
Lus10025782 6.4 0.7869
AT4G20270 BAM3 BARELY ANY MERISTEM 3, Leucine... Lus10043327 8.6 0.7800
AT3G17220 ATPMEI2 pectin methylesterase inhibito... Lus10017345 12.1 0.7676
AT1G69630 F-box/RNI-like superfamily pro... Lus10011410 13.7 0.7673
AT1G52820 2-oxoglutarate (2OG) and Fe(II... Lus10005516 14.1 0.7156
AT2G04305 Magnesium transporter CorA-lik... Lus10035643 14.7 0.7479
AT3G54140 ATPTR1 ARABIDOPSIS THALIANA PEPTIDE T... Lus10017176 15.0 0.7238
AT3G49780 ATPSK3(FORMERSY... phytosulfokine 4 precursor (.1... Lus10011721 16.6 0.7463
AT1G09600 Protein kinase superfamily pro... Lus10028890 17.5 0.7074

Lus10020064 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.