Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11530 144 / 9e-46 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1) AT3G08710 89 / 2e-23 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT3G51030 85 / 2e-22 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT2G40790 85 / 6e-22 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1) AT3G56420 84 / 2e-21 Thioredoxin superfamily protein (.1) AT1G45145 81 / 9e-21 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT5G42980 76 / 8e-19 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G59730 75 / 3e-18 ATH7 thioredoxin H-type 7 (.1) AT1G19730 73 / 1e-17 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT1G69880 70 / 3e-16 ATH8 thioredoxin H-type 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018383 [exp] 165 / 1e-53 AT1G11530 145 / 3e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10007630 [exp] 162 / 2e-52 AT1G11530 143 / 4e-45 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10022727 [exp] 95 / 6e-26 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014186 [exp] 94 / 1e-25 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014277 [exp] 91 / 2e-24 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 83 / 2e-21 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10041799 [exp] 83 / 2e-21 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 79 / 5e-20 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 78 / 3e-19 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G031700 [exp] 161 / 2e-52 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.001G416500 [exp] 138 / 4e-43 AT1G11530 162 / 1e-52 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.016G138800 [exp] 96 / 3e-26 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.006G110100 [exp] 95 / 4e-26 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.007G018000 [exp] 89 / 6e-24 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.019G062000 [exp] 89 / 1e-23 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.011G031100 [exp] 82 / 4e-21 AT1G11530 94 / 9e-26 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.005G232700 [exp] 81 / 1e-20 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 79 / 5e-20 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.015G036000 [exp] 80 / 2e-18 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10020070 pacid=23156202 polypeptide=Lus10020070 locus=Lus10020070.g ID=Lus10020070.BGIv1.0 annot-version=v1.0 ATGGAGAGCCATGGGCAGGAAATCAAGGCAAACATCGTAAAGGTTGAATCTTTGCAGCAATGGGATTCCAAACTTAGCCAGGCTTCCCCTGTTATAGTCC ATTTTACAGCTTCGTGGTGCATGCCTTCAGTGGCGATGAACTTTTTCTTTGAAGAGTTAGCCTTTACGTATCCAGATGCTGTTTTCCTAGTTGTTGATGT CGATGAACTCAAGGTTGTGGCCGATAAACTGGAGGTGAAGGCGATGCCTACTTTCATGCTAATCAAGGATGGGAATCAGGCTGACAAGATCGTTGGAGCC AATTCAGAAGAAGTGAGGAAAAGGGTCGACAGTTTCATCCAATCTTGTACTTCTCGCCCATTTCAACCCCAACCATACTAA
AA sequence Show only first row Show all	>Lus10020070 pacid=23156202 polypeptide=Lus10020070 locus=Lus10020070.g ID=Lus10020070.BGIv1.0 annot-version=v1.0 MESHGQEIKANIVKVESLQQWDSKLSQASPVIVHFTASWCMPSVAMNFFFEELAFTYPDAVFLVVDVDELKVVADKLEVKAMPTFMLIKDGNQADKIVGA NSEEVRKRVDSFIQSCTSRPFQPQPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Lus10020070 [exp]	0	1
AT4G17770		ATTPS5	TREHALOSE -6-PHOSPHATASE SYNTH...		Lus10019982 [exp]	1.0	0.9444
AT1G54100		ALDH7B4	aldehyde dehydrogenase 7B4 (.1...		Lus10008117 [exp]	2.8	0.9293
AT3G48530		KING1	SNF1-related protein kinase re...		Lus10022458 [exp]	3.9	0.9196
AT1G03290			unknown protein		Lus10012382 [exp]	4.2	0.9090
AT1G11020			RING/FYVE/PHD zinc finger supe...		Lus10017764 [exp]	7.1	0.8996
AT5G06560			Protein of unknown function, D...		Lus10029342 [exp]	7.7	0.8951
AT5G05140			Transcription elongation facto...		Lus10039000 [exp]	7.7	0.9176
AT5G05140			Transcription elongation facto...		Lus10027295 [exp]	10.9	0.9119
AT2G18700		ATTPSB, ATTPS11	TREHALOSE-6-PHOSPHATE SYNTHASE...		Lus10015509 [exp]	11.3	0.9220
AT5G05700		ATATE1, DLS1, A...	DELAYED LEAF SENESCENCE 1, arg...		Lus10004392 [exp]	12.0	0.8784

Compare expression of checked genes

Lus10020070 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.