Lus10020078 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21390 257 / 2e-80 B120 S-locus lectin protein kinase family protein (.1)
AT1G11340 257 / 2e-80 S-locus lectin protein kinase family protein (.1)
AT4G23230 239 / 1e-76 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1)
AT4G23280 242 / 2e-76 CRK20 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1)
AT4G23180 241 / 5e-76 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
AT4G11530 241 / 6e-76 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 (.1)
AT4G23320 234 / 1e-75 CRK24 cysteine-rich RLK (RECEPTOR-like protein kinase) 24 (.1)
AT4G23310 243 / 2e-75 CRK23 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1)
AT4G05200 239 / 3e-75 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
AT4G23240 230 / 4e-75 CRK16 cysteine-rich RLK (RECEPTOR-like protein kinase) 16 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006745 407 / 6e-140 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10006746 386 / 4e-130 AT1G11340 836 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10020052 340 / 3e-112 AT1G11340 858 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10037733 244 / 4e-80 AT4G21380 402 / 9e-134 receptor kinase 3 (.1)
Lus10007600 259 / 1e-79 AT1G11300 930 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
Lus10018408 255 / 2e-79 AT4G21390 936 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10016871 253 / 3e-79 AT4G27290 752 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10037729 253 / 5e-79 AT4G27290 750 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10014812 250 / 6e-78 AT4G27290 749 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G028701 287 / 1e-91 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G028466 285 / 2e-91 AT1G11340 884 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G028600 285 / 3e-91 AT1G11340 875 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G125100 266 / 5e-84 AT4G27290 856 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G025001 255 / 6e-83 AT4G05200 465 / 4e-158 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.010G015400 259 / 7e-83 AT4G27290 683 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G018600 261 / 2e-82 AT4G27290 853 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G027800 261 / 4e-82 AT4G21390 941 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.001G409300 260 / 5e-82 AT4G27290 875 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G037300 260 / 9e-82 AT4G21390 922 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence
>Lus10020078 pacid=23156240 polypeptide=Lus10020078 locus=Lus10020078.g ID=Lus10020078.BGIv1.0 annot-version=v1.0
ATGGCGTTTTGCCTCATACAGGGAAAAAAGAAAGCTCGAGACAGAGTTGATAAACTTTCGTTCTACTTCGACACCACCAACTCGGATGACTCCGTGAGCC
AGAAGAATGGCAATGCACATTTGCCATTCTTCCATCTCAGTGAGATAGCAGCCGCCACGAACAATTTCTCTGACGAGAACAAGCTTGGAGAAGGCGGATT
TGGGTCCGTCTACAAGGGTACGTACAAAGGGAACGAAATAGCAGTGAAAAGGCTATCCAAGTACTCAGGACAAGGTGGTGAGGAGTTCGAGAACGAGGTG
GAGTTGATTGCCAAGCTGCAACACAGAAATCTTGTTATGATTCTTGGTTGTTGTGTGCAAGGACATGAAATGATTTTGGTCTATGAATATTTGCCCAACA
AAAGTCTGGACTACTTCATTTTCGACGAGGTTAAGAAGGCATTGCTAGATTGGCCGATTCGGTACAACATTATATGTGTAATAGCTCGAGGGATTTTGTA
CCTGCTCGAGGATTCAAGGCTTAGAATCATACGTAGAGATCTCAAGGCTAATAATGTCTTGCTTGATGTTTCCATGAATCCTAAAATATCAGATTTTAGA
ATGGCTCGAATTTTCGGGATGGATCAGAATGAAGCCAACACAAATCGTGTAATAGGGACATAG
AA sequence
>Lus10020078 pacid=23156240 polypeptide=Lus10020078 locus=Lus10020078.g ID=Lus10020078.BGIv1.0 annot-version=v1.0
MAFCLIQGKKKARDRVDKLSFYFDTTNSDDSVSQKNGNAHLPFFHLSEIAAATNNFSDENKLGEGGFGSVYKGTYKGNEIAVKRLSKYSGQGGEEFENEV
ELIAKLQHRNLVMILGCCVQGHEMILVYEYLPNKSLDYFIFDEVKKALLDWPIRYNIICVIARGILYLLEDSRLRIIRRDLKANNVLLDVSMNPKISDFR
MARIFGMDQNEANTNRVIGT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G11340 S-locus lectin protein kinase ... Lus10020078 0 1

Lus10020078 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.