Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08750 45 / 6e-06 F-box and associated interaction domains-containing protein (.1) AT1G67130 45 / 7e-06 F-box family protein (.1) AT2G40920 44 / 2e-05 F-box and associated interaction domains-containing protein (.1.2) AT3G07870 44 / 2e-05 F-box and associated interaction domains-containing protein (.1) AT2G16810 43 / 3e-05 F-box and associated interaction domains-containing protein (.1) AT1G47340 43 / 3e-05 F-box and associated interaction domains-containing protein (.1) AT2G41473 40 / 5e-05 F-box family protein (.1) AT2G40910 42 / 0.0001 F-box and associated interaction domains-containing protein (.1.2) AT3G61340 42 / 0.0001 F-box and associated interaction domains-containing protein (.1) AT3G47150 41 / 0.0001 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006742 [exp] 135 / 5e-37 AT4G21390 800 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10011538 [exp] 114 / 2e-31 AT1G47340 50 / 9e-07 F-box and associated interaction domains-containing protein (.1) Lus10018193 [exp] 94 / 7e-24 AT1G53790 42 / 1e-04 F-box and associated interaction domains-containing protein (.1.2) Lus10014937 [exp] 57 / 9e-10 AT3G06240 79 / 4e-16 F-box family protein (.1) Lus10001105 [exp] 52 / 2e-08 AT3G06240 109 / 3e-26 F-box family protein (.1) Lus10014935 [exp] 52 / 5e-08 AT3G06240 84 / 2e-17 F-box family protein (.1) Lus10018008 [exp] 51 / 7e-08 AT3G16210 82 / 6e-17 F-box family protein (.1) Lus10028961 [exp] 49 / 5e-07 AT4G12560 81 / 2e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10029725 [exp] 49 / 5e-07 AT3G06240 74 / 3e-14 F-box family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G058900 [exp] 50 / 2e-07 AT3G06240 132 / 2e-34 F-box family protein (.1) Potri.001G318400 [exp] 49 / 4e-07 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.001G318300 [exp] 47 / 1e-06 AT3G06240 140 / 7e-38 F-box family protein (.1) Potri.017G058000 [exp] 43 / 3e-05 AT3G06240 138 / 5e-37 F-box family protein (.1) Potri.008G144000 [exp] 42 / 6e-05 AT4G38870 97 / 6e-22 F-box and associated interaction domains-containing protein (.1) Potri.008G199601 [exp] 40 / 6e-05 AT3G06240 61 / 2e-12 F-box family protein (.1) Potri.001G262900 [exp] 42 / 7e-05 AT4G12560 107 / 5e-26 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G458400 [exp] 42 / 8e-05 AT2G31470 113 / 8e-28 DROUGHT TOLERANCE REPRESSOR, F-box and associated interaction domains-containing protein (.1) Potri.010G207500 [exp] 42 / 9e-05 AT4G12560 94 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.006G170300 [exp] 41 / 0.0002 AT4G12560 69 / 1e-12 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020082 pacid=23156122 polypeptide=Lus10020082 locus=Lus10020082.g ID=Lus10020082.BGIv1.0 annot-version=v1.0 ATGACGACGGAGAAGAAGAACACAGCAACACCGGCGGCAAGTAGTACCAGTCATCGTAGTCGACACTTGCCGGAGGATTTGATCGTCGACATTCAAATGA GGCTGCCGGTGTCCTGCCTACCGCGACTCAGTTGCGTAAATAAATCTTGGAAGTCCCTACTCTCAGACCATAAATTCCTTTACCAGCGCCTTTTCGACGA TCAGACTGAAGATCCAAACACTCGGATCCTCATTACCCTAGCTACCCCATCGGAGCATCGAAATCATTATCTTTACACTTCTATTCCCTATGATTCTGGC CTCCCTCTGCTTAGTGATGCTACTTTCCTGGAATTCCCGGATAACCCTCTCGACCTATCCTATTTATCCAAGTTGAGGATGAGCTCCTGCGGAGGAGGGT TGATTTGCTTAGAATACGATAACTGGACGATCAAGGAGTCTGTCCAATTATTGTGTTGTTTGATCCGGCCGCTCACCATACAAAGATGCTTCCTCCATTG GCAAGTTTAA
AA sequence Show only first row Show all	>Lus10020082 pacid=23156122 polypeptide=Lus10020082 locus=Lus10020082.g ID=Lus10020082.BGIv1.0 annot-version=v1.0 MTTEKKNTATPAASSTSHRSRHLPEDLIVDIQMRLPVSCLPRLSCVNKSWKSLLSDHKFLYQRLFDDQTEDPNTRILITLATPSEHRNHYLYTSIPYDSG LPLLSDATFLEFPDNPLDLSYLSKLRMSSCGGGLICLEYDNWTIKESVQLLCCLIRPLTIQRCFLHWQV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40920			F-box and associated interacti...		Lus10020082 [exp]	0	1
AT1G69800			Cystathionine beta-synthase (C...		Lus10030788 [exp]	3.7	0.8618
					Lus10033476 [exp]	4.1	0.8626
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10020722 [exp]	5.3	0.8199
AT5G07740			actin binding (.1)		Lus10015725 [exp]	5.5	0.8205
AT1G30690			Sec14p-like phosphatidylinosit...		Lus10031175 [exp]	8.0	0.8341
AT1G18010			Major facilitator superfamily ...		Lus10043370 [exp]	8.4	0.8267
AT1G69020			Prolyl oligopeptidase family p...		Lus10032378 [exp]	9.0	0.8132
AT4G26590		ATOPT5	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10022312 [exp]	10.0	0.8115
AT3G49250		IDN1, DMS3	INVOLVED IN DE NOVO 1, defecti...		Lus10030244 [exp]	10.8	0.8018
AT2G34090		MEE18	maternal effect embryo arrest ...		Lus10000989 [exp]	11.2	0.8378

Compare expression of checked genes

Lus10020082 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.