Lus10020102 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G10750 132 / 3e-39 Protein of unknown function (DUF1336) (.1)
AT5G25020 100 / 5e-27 Protein of unknown function (DUF1336) (.1)
AT4G19040 94 / 1e-23 EDR2 ENHANCED DISEASE RESISTANCE 2 (.1.2.3)
AT5G45560 92 / 4e-23 Pleckstrin homology (PH) domain-containing protein / lipid-binding START domain-containing protein (.1)
AT5G24990 91 / 5e-23 Protein of unknown function (DUF1336) (.1)
AT1G06050 89 / 3e-22 Protein of unknown function (DUF1336) (.1)
AT5G25010 87 / 1e-21 Protein of unknown function (DUF1336) (.1)
AT5G35180 75 / 7e-17 Protein of unknown function (DUF1336) (.1), Protein of unknown function (DUF1336) (.2), Protein of unknown function (DUF1336) (.3), Protein of unknown function (DUF1336) (.4)
AT2G28320 62 / 3e-12 Pleckstrin homology (PH) and lipid-binding START domains-containing protein (.1)
AT3G54800 58 / 5e-11 Pleckstrin homology (PH) and lipid-binding START domains-containing protein (.1), Pleckstrin homology (PH) and lipid-binding START domains-containing protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026907 171 / 2e-54 AT5G10750 416 / 1e-147 Protein of unknown function (DUF1336) (.1)
Lus10026242 162 / 1e-50 AT5G10750 440 / 1e-156 Protein of unknown function (DUF1336) (.1)
Lus10042428 153 / 5e-47 AT5G10750 444 / 6e-158 Protein of unknown function (DUF1336) (.1)
Lus10012149 91 / 2e-22 AT4G19040 1227 / 0.0 ENHANCED DISEASE RESISTANCE 2 (.1.2.3)
Lus10007596 90 / 4e-22 AT4G19040 1217 / 0.0 ENHANCED DISEASE RESISTANCE 2 (.1.2.3)
Lus10008154 79 / 1e-18 AT1G06050 362 / 5e-126 Protein of unknown function (DUF1336) (.1)
Lus10005308 75 / 3e-17 AT1G06050 191 / 3e-59 Protein of unknown function (DUF1336) (.1)
Lus10040015 76 / 4e-17 AT5G35180 1034 / 0.0 Protein of unknown function (DUF1336) (.1), Protein of unknown function (DUF1336) (.2), Protein of unknown function (DUF1336) (.3), Protein of unknown function (DUF1336) (.4)
Lus10019591 73 / 4e-16 AT5G35180 931 / 0.0 Protein of unknown function (DUF1336) (.1), Protein of unknown function (DUF1336) (.2), Protein of unknown function (DUF1336) (.3), Protein of unknown function (DUF1336) (.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G014234 127 / 9e-37 AT5G10750 428 / 5e-152 Protein of unknown function (DUF1336) (.1)
Potri.003G100600 93 / 3e-23 AT4G19040 1182 / 0.0 ENHANCED DISEASE RESISTANCE 2 (.1.2.3)
Potri.001G132900 93 / 3e-23 AT4G19040 1159 / 0.0 ENHANCED DISEASE RESISTANCE 2 (.1.2.3)
Potri.008G213000 90 / 3e-22 AT4G19040 1017 / 0.0 ENHANCED DISEASE RESISTANCE 2 (.1.2.3)
Potri.017G027700 75 / 4e-17 AT1G06050 399 / 4e-140 Protein of unknown function (DUF1336) (.1)
Potri.007G130400 71 / 2e-15 AT1G06050 390 / 1e-136 Protein of unknown function (DUF1336) (.1)
Potri.008G038800 66 / 1e-13 AT3G54800 922 / 0.0 Pleckstrin homology (PH) and lipid-binding START domains-containing protein (.1), Pleckstrin homology (PH) and lipid-binding START domains-containing protein (.2)
Potri.018G113100 66 / 1e-13 AT5G35180 1028 / 0.0 Protein of unknown function (DUF1336) (.1), Protein of unknown function (DUF1336) (.2), Protein of unknown function (DUF1336) (.3), Protein of unknown function (DUF1336) (.4)
Potri.009G011200 65 / 2e-13 AT2G28320 1071 / 0.0 Pleckstrin homology (PH) and lipid-binding START domains-containing protein (.1)
Potri.010G223400 63 / 1e-12 AT3G54800 922 / 0.0 Pleckstrin homology (PH) and lipid-binding START domains-containing protein (.1), Pleckstrin homology (PH) and lipid-binding START domains-containing protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07059 DUF1336 Protein of unknown function (DUF1336)
Representative CDS sequence
>Lus10020102 pacid=23142057 polypeptide=Lus10020102 locus=Lus10020102.g ID=Lus10020102.BGIv1.0 annot-version=v1.0
ATGGAAAGGACGTTGTCAATCGGCTCACTTTTGGGAAAAGCGCTGACGTGCAATTACCACAGGGGACCTAATTACTTGGAGATCGATGTGGATATAGGGA
GCTCGGCGATAGCGACGGCGATACTGCATTTGGCGTTGGGATGCGTGACCAGCGTGACGATCGACATGGGGTTCGTGGTGGAGGCGCAGGAGGAAGAGGA
GCTGCCGGAGAGGTTGATAGGAGCGGTTAGGATTTGTCAGATGGAGATGTCGTCGGCTACGGTTGTGGAAATGCAGACGGGTGGCGGGCGAGGGTCGACA
GGATTGGCGAAGGTGAACCATCACGAAGAGGAACGATGA
AA sequence
>Lus10020102 pacid=23142057 polypeptide=Lus10020102 locus=Lus10020102.g ID=Lus10020102.BGIv1.0 annot-version=v1.0
MERTLSIGSLLGKALTCNYHRGPNYLEIDVDIGSSAIATAILHLALGCVTSVTIDMGFVVEAQEEEELPERLIGAVRICQMEMSSATVVEMQTGGGRGST
GLAKVNHHEEER

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G10750 Protein of unknown function (D... Lus10020102 0 1
AT5G24090 ATCHIA chitinase A (.1) Lus10023535 2.0 0.8217
Lus10007510 2.8 0.7881
AT5G12180 CPK17 calcium-dependent protein kina... Lus10023346 4.5 0.7697
AT5G41010 NRPE12, NRPD12,... DNA directed RNA polymerase, 7... Lus10007891 6.2 0.7882
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10020723 6.7 0.7432
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10019652 9.2 0.7494
AT2G34930 disease resistance family prot... Lus10033931 12.2 0.7577
AT5G24090 ATCHIA chitinase A (.1) Lus10023534 14.1 0.7464
AT4G20990 ATACA4, ACA4 A. THALIANA ALPHA CARBONIC ANH... Lus10018017 14.4 0.8058
AT5G40380 CRK42 cysteine-rich RLK (RECEPTOR-li... Lus10008764 15.2 0.6788

Lus10020102 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.