Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31590 56 / 9e-11 ATCSLC5, ATCSLC05 CELLULOSE-SYNTHASE LIKE C5, Cellulose-synthase-like C5 (.1) AT2G24630 54 / 3e-10 ATCSLC8, ATCSLC08 CELLULOSE-SYNTHASE LIKE C8, Glycosyl transferase family 2 protein (.1) AT4G07960 53 / 8e-10 ATCSLC12 CELLULOSE-SYNTHASE LIKE C12, Cellulose-synthase-like C12 (.1) AT3G07330 52 / 1e-09 ATCSLC6, ATCSLC06 CELLULOSE-SYNTHASE LIKE C6, Cellulose-synthase-like C6 (.1) AT3G28180 47 / 1e-07 ATCSLC4, CSLC4, ATCSLC04 CELLULOSE-SYNTHASE LIKE C4, Cellulose-synthase-like C4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026923 [exp] 61 / 2e-12 AT4G31590 1078 / 0.0 CELLULOSE-SYNTHASE LIKE C5, Cellulose-synthase-like C5 (.1) Lus10038217 [exp] 55 / 2e-10 AT3G07330 821 / 0.0 CELLULOSE-SYNTHASE LIKE C6, Cellulose-synthase-like C6 (.1) Lus10018651 [exp] 52 / 1e-09 AT4G07960 978 / 0.0 CELLULOSE-SYNTHASE LIKE C12, Cellulose-synthase-like C12 (.1) Lus10007715 [exp] 52 / 1e-09 AT4G07960 1010 / 0.0 CELLULOSE-SYNTHASE LIKE C12, Cellulose-synthase-like C12 (.1) Lus10025886 [exp] 52 / 2e-09 AT3G07330 994 / 0.0 CELLULOSE-SYNTHASE LIKE C6, Cellulose-synthase-like C6 (.1) Lus10039440 [exp] 49 / 3e-08 AT3G28180 1035 / 0.0 CELLULOSE-SYNTHASE LIKE C4, Cellulose-synthase-like C4 (.1) Lus10039475 [exp] 48 / 4e-08 AT3G28180 1035 / 0.0 CELLULOSE-SYNTHASE LIKE C4, Cellulose-synthase-like C4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G270900 [exp] 56 / 5e-11 AT4G31590 1085 / 0.0 CELLULOSE-SYNTHASE LIKE C5, Cellulose-synthase-like C5 (.1) Potri.018G009300 [exp] 56 / 6e-11 AT4G31590 1077 / 0.0 CELLULOSE-SYNTHASE LIKE C5, Cellulose-synthase-like C5 (.1) Potri.002G248400 [exp] 54 / 5e-10 AT3G07330 957 / 0.0 CELLULOSE-SYNTHASE LIKE C6, Cellulose-synthase-like C6 (.1) Potri.002G114200 [exp] 51 / 4e-09 AT4G07960 1031 / 0.0 CELLULOSE-SYNTHASE LIKE C12, Cellulose-synthase-like C12 (.1) Potri.005G146900 [exp] 51 / 4e-09 AT4G07960 1050 / 0.0 CELLULOSE-SYNTHASE LIKE C12, Cellulose-synthase-like C12 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020121 pacid=23142059 polypeptide=Lus10020121 locus=Lus10020121.g ID=Lus10020121.BGIv1.0 annot-version=v1.0 ATGGAAGAAGCAGCTGCAGCAGTGCCGAAACCGAAAAAGATAGTGAACAAGATTTACAGGAAGGAGCTAGCTCTTGCATTCCTCTTGCTCACAGCTTCTG CAAGGAGTCTCTTATCTGCTCAAGGAGTCCATTTCTACTTCCTTCTGTTCCAAGGTGTCACATTTCTGTTGGTGGGTTTGGACCTCATTGGACAGCAAAT GACTTGA
AA sequence Show only first row Show all	>Lus10020121 pacid=23142059 polypeptide=Lus10020121 locus=Lus10020121.g ID=Lus10020121.BGIv1.0 annot-version=v1.0 MEEAAAAVPKPKKIVNKIYRKELALAFLLLTASARSLLSAQGVHFYFLLFQGVTFLLVGLDLIGQQMT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G07960		ATCSLC12	CELLULOSE-SYNTHASE LIKE C12, C...		Lus10020121 [exp]	0	1
AT1G26120		ICME-LIKE1	Isoprenylcysteine methylestera...		Lus10035064 [exp]	1.7	0.8778
AT3G12610		DRT100	DNA-DAMAGE REPAIR/TOLERATION 1...		Lus10037705 [exp]	3.7	0.8764
AT1G26355		SP1L1	SPIRAL1-like1 (.1)		Lus10034675 [exp]	3.9	0.8680
AT1G06850	bZIP	ATBZIP52	basic leucine-zipper 52 (.1.2)		Lus10024204 [exp]	4.5	0.8698
AT4G31590		ATCSLC5, ATCSLC...	CELLULOSE-SYNTHASE LIKE C5, Ce...		Lus10020120 [exp]	7.7	0.8678
AT4G18760		AtRLP51	receptor like protein 51 (.1)		Lus10015226 [exp]	9.9	0.8411
AT5G19770		TUA3	tubulin alpha-3 (.1)		Lus10013765 [exp]	10.2	0.8659
AT4G12420		SKU5	Cupredoxin superfamily protein...		Lus10024604 [exp]	11.3	0.8655
AT1G53470		MSL4	mechanosensitive channel of sm...		Lus10042499 [exp]	14.4	0.8380
AT3G58100		PDCB5	plasmodesmata callose-binding ...		Lus10002193 [exp]	15.7	0.8187

Compare expression of checked genes

Lus10020121 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.