Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24590 159 / 1e-49 RSZ22a, At-RSZ22a RS-containing zinc finger protein 22a, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT4G31580 154 / 8e-48 SRZ22, RSZP22, SRZ-22, RSZ22, At-RSZ22 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) AT1G23860 144 / 4e-44 SRZ21, SRZ-21, RSZP21, RSZ21, At-RSZ21 RS-containing zinc finger protein 21 (.1.2.3.4) AT1G02840 67 / 2e-13 ATSRP34, SR1, SR34, At-SR34 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT4G02430 62 / 2e-12 SR34b, At-SR34b Serine/Arginine-Rich Protein Splicing Factor 34b, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT3G53500 59 / 9e-11 RSZ32, RS2Z32, At-RS2Z arginine/serine-rich zinc knuckle-containing protein 32, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) AT2G37340 59 / 1e-10 RSZ33, ATRSZ33, RS2Z33, AT-RS2Z33 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) AT3G49430 57 / 5e-10 SRP34A, SR34a, At-SR34a Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3) AT1G09140 56 / 1e-09 ATSRP30.1, ATSRP30.2, SR30, At-SR30 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) AT1G60650 55 / 4e-09 AtRZ-1b AtRZ-1b, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026925 [exp] 180 / 2e-58 AT4G31580 184 / 2e-59 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10030858 [exp] 161 / 2e-49 AT4G31580 166 / 9e-51 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10030631 [exp] 159 / 2e-49 AT4G31580 164 / 9e-51 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10012994 [exp] 159 / 5e-49 AT4G31580 162 / 3e-50 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10029171 [exp] 160 / 5e-48 AT4G31580 160 / 5e-47 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10003606 [exp] 66 / 5e-13 AT1G02840 299 / 5e-102 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10007869 [exp] 65 / 9e-13 AT1G02840 308 / 1e-105 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10008218 [exp] 65 / 1e-12 AT1G02840 228 / 3e-73 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10029885 [exp] 62 / 1e-11 AT1G02840 253 / 2e-81 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G272400 [exp] 162 / 3e-51 AT2G24590 152 / 4e-47 RS-containing zinc finger protein 22a, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Potri.018G009100 [exp] 162 / 3e-51 AT4G31580 174 / 2e-55 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Potri.019G050600 [exp] 155 / 1e-48 AT1G23860 131 / 3e-39 RS-containing zinc finger protein 21 (.1.2.3.4) Potri.014G129900 [exp] 64 / 2e-12 AT1G02840 272 / 5e-91 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.013G015500 [exp] 62 / 6e-12 AT1G09140 263 / 7e-88 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) Potri.002G205025 [exp] 62 / 8e-12 AT1G02840 272 / 1e-90 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.015G004600 [exp] 60 / 4e-11 AT3G49430 303 / 1e-103 Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3) Potri.005G024600 [exp] 60 / 5e-11 AT1G09140 258 / 6e-86 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) Potri.006G215200 [exp] 60 / 7e-11 AT2G37340 266 / 6e-89 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) Potri.012G021800 [exp] 59 / 8e-11 AT3G49430 317 / 2e-108 Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0511 [flax] [poplar] Retroviral_zf PF00098 [flax] [poplar] zf-CCHC Zinc knuckle CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Lus10020123 pacid=23142046 polypeptide=Lus10020123 locus=Lus10020123.g ID=Lus10020123.BGIv1.0 annot-version=v1.0 ATGTCTCGTGTTTACGTGGGAAATTTGGATCCTCGGGTTACTGAGCGTGATCTTGAGGACGAATTCAGGAAATTCGGTGTAATCAGAAGTGTTTGGGTTG CACGACGACCTCCAGGTTATGCCTTTGTCGATTTTGATGACAAAAGGGATGCAGAAGATGCTATTCGTGAGATAGATGGGAAAAACGGTTGGAGAGTTGA GATGTCCCACAACTCAAAAGGTGGAGGTGGAGGTGGAAGTGGCCGTGGTGGAGGGGGTGGTCGTGGTGGAGGATCTGATTTGAAGTGCTATGAGTGTGGT GAGGCTGGTCATTTTGCACGTGAATGCCACTCACGGGGTGGCTCAGGAAGGAGACGTAGCCGCAGCCCAGCATACAGAAGAAGTCCCAGTTATGGCCGAA GGAGTTACAGTCCTCGAGAAAGATCCCCTAAACGCCGTAGCCCTTCACCTCGCAGGCGCAGCTACAGCAGGTCGCCACCATACCGTGGGCGTGAAGAAGC ACCATATGCTAATGGGTGA
AA sequence Show only first row Show all	>Lus10020123 pacid=23142046 polypeptide=Lus10020123 locus=Lus10020123.g ID=Lus10020123.BGIv1.0 annot-version=v1.0 MSRVYVGNLDPRVTERDLEDEFRKFGVIRSVWVARRPPGYAFVDFDDKRDAEDAIREIDGKNGWRVEMSHNSKGGGGGGSGRGGGGGRGGGSDLKCYECG EAGHFARECHSRGGSGRRRSRSPAYRRSPSYGRRSYSPRERSPKRRSPSPRRRSYSRSPPYRGREEAPYANG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31580		SRZ22, RSZP22, ...	RS-containing zinc finger prot...		Lus10020123 [exp]	0	1
AT5G10320			unknown protein		Lus10000634 [exp]	2.8	0.8189
					Lus10024697 [exp]	8.7	0.8048
AT5G48970			Mitochondrial substrate carrie...		Lus10037508 [exp]	13.5	0.7932
AT1G69010	bHLH	bHLH102, BIM2	BES1-interacting Myc-like prot...		Lus10005091 [exp]	13.7	0.8337
AT5G51410			LUC7 N_terminus domain-contain...		Lus10031156 [exp]	13.9	0.8066
AT1G67260	TCP	TCP1	TCP family transcription facto...		Lus10003078 [exp]	15.4	0.6987
AT1G51740		ATSYP81, SYP81,...	ORTHOLOG OF YEAST UFE1 \(UNKNO...		Lus10040237 [exp]	15.4	0.8020
					Lus10043073 [exp]	16.6	0.7985
AT1G16916			unknown protein		Lus10032325 [exp]	17.0	0.7977
AT3G08720		ATPK2, ATPK19, ...	ARABIDOPSIS THALIANA SERINE/TH...		Lus10036653 [exp]	17.4	0.7992

Compare expression of checked genes

Lus10020123 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.