Lus10020126 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 55 / 4e-10 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT2G40610 39 / 0.0008 ATHEXPALPHA1.11, ATEXP8, ATEXPA8 expansin A8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020125 167 / 4e-54 AT2G18660 63 / 2e-13 plant natriuretic peptide A (.1)
Lus10020127 102 / 2e-28 AT2G18660 50 / 1e-08 plant natriuretic peptide A (.1)
Lus10026929 85 / 1e-21 AT2G18660 53 / 1e-09 plant natriuretic peptide A (.1)
Lus10020130 70 / 4e-15 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10026930 70 / 5e-15 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10020128 69 / 4e-14 ND 48 / 6e-07
Lus10020129 64 / 2e-13 AT2G18660 44 / 2e-06 plant natriuretic peptide A (.1)
Lus10026931 64 / 1e-12 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Lus10020131 54 / 2e-09 AT2G18660 59 / 2e-11 plant natriuretic peptide A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G218300 62 / 1e-12 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.018G101600 60 / 5e-12 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G179300 54 / 1e-09 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G031901 47 / 4e-07 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.018G098200 44 / 3e-06 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.006G252200 43 / 1e-05 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.018G029100 42 / 2e-05 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G155000 41 / 5e-05 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Potri.019G057500 42 / 7e-05 AT2G40610 374 / 2e-132 expansin A8 (.1)
Potri.006G249500 41 / 7e-05 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10020126 pacid=23142066 polypeptide=Lus10020126 locus=Lus10020126.g ID=Lus10020126.BGIv1.0 annot-version=v1.0
ATGGCGCACAACCACTCATCATCAGCACCTCTCCTGCAGCTTGCACTCTTACTTGTGCAGCTCTCTATCTGGCGTTCCGGAGCTACCATGTTCTACGGAA
CTGCTAGCTTTACCCGACCTCCTTACCATTCCTCGTGCACTGATGGTATCACAACCAACTACGAGACGTTTGCGGCAGTGCCAAGCTGGGTGTACCAAGA
TGGTGTGGCTTGCGGGACCAAATACAGAGTTACTTGCGCTGACGAAGCATGCCTCGCGAATGGACCAACGTCTATAACGGTCACTGTTGCCGACGTCTGT
ACACCAGACAAGCCTACCGAGCCTTGCCCAACCTTGGTGCTGTCGGAGGAAACGTTCCAAACATTTGCAGACACTGATGCAGGCATTATTGCCATTTACT
ATGAACTAATGAGAACCCTTGGACAAGATTCTGACTCCTCCTCTGTCAGAGACAACAACCCNNNNNNNNNTTGA
AA sequence
>Lus10020126 pacid=23142066 polypeptide=Lus10020126 locus=Lus10020126.g ID=Lus10020126.BGIv1.0 annot-version=v1.0
MAHNHSSSAPLLQLALLLVQLSIWRSGATMFYGTASFTRPPYHSSCTDGITTNYETFAAVPSWVYQDGVACGTKYRVTCADEACLANGPTSITVTVADVC
TPDKPTEPCPTLVLSEETFQTFADTDAGIIAIYYELMRTLGQDSDSSSVRDNNXXXX

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10020126 0 1

Lus10020126 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.