Lus10020128 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 47 / 1e-06 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026929 124 / 3e-35 AT2G18660 53 / 1e-09 plant natriuretic peptide A (.1)
Lus10020129 123 / 1e-34 AT2G18660 44 / 2e-06 plant natriuretic peptide A (.1)
Lus10026928 104 / 2e-28 ND /
Lus10007708 74 / 3e-15 AT1G48120 42 / 2e-04 hydrolases;protein serine/threonine phosphatases (.1)
Lus10032771 72 / 7e-15 ND /
Lus10020126 68 / 8e-14 AT2G18660 57 / 7e-11 plant natriuretic peptide A (.1)
Lus10020125 61 / 2e-11 AT2G18660 63 / 2e-13 plant natriuretic peptide A (.1)
Lus10026931 62 / 9e-11 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Lus10026930 61 / 1e-10 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G101600 50 / 2e-07 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G179300 49 / 4e-07 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.003G218300 46 / 3e-06 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.018G098200 45 / 6e-06 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.006G155000 44 / 2e-05 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Potri.014G066300 44 / 9e-05 AT1G65680 322 / 2e-111 expansin B2 (.1)
Potri.006G176300 42 / 9e-05 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10020128 pacid=23142040 polypeptide=Lus10020128 locus=Lus10020128.g ID=Lus10020128.BGIv1.0 annot-version=v1.0
ATGTATTTCAAACTTCATAACAAGTCCTCATCAATTCCAACAAACACATCATCAAAGTCACACACACTAGCAAATCGAATCCCTTGTCCCATTACCCTCG
CCCTCACCTCACCCAGCTCACCCGCGACACGGCCGGAAACCCCATCCACTCCACCCCGGCAGTCGACACTCCCCCAATTCGGTGATCCCTTCCCTCCGAC
GGTTCGACCCACACACAGCAGCAAGCATTCAGCACATGCAGCACTCCCCCGAATCCCGATTCCTTCCCTTCGAGTCTTCGACCCAGCAAGCAGAGCTGCA
GCACGGGCAGCACCGCAGCAGCACTCCAGGCTCCAGGTCTTGGCGACGGCGAGCAGGTGCCAGGCAGCGGCTGGCTGCACCGTCCCCGTAGCTGAGTCGG
TTAAATCGATCAGAGCCGTTTACAATGATTCCTGTTCTGGTATTGACCCAGAAAACTACATGGTCGCCGCAGTAAGCGACGAACTCATATCTGAAGGTTT
CGGTTGCGGAACCAAATTCATAATAACTTGCGTGGCGAGTTCGGACAATGCATGCCTACCATCGGCACAACCTATCACGATCACTGTAGCCGATGACTGC
AAACCGGAGCCGCCTCGTTACGAGAAATGCCCTACTTTCGTTCTGTCAAAACAAGTTTACTCAGCCATTGCAAACACTGATGCTGGCGTTGAACCTAGTG
TTACCCTCGCGTGCTGTAGGGCGTCTCACATCCCTCCATACCATCCCCACTTATGCCATTTTTTGGAGGCTGTTGGACTCTTATCGATTGTTGATCTTGT
GACCCTTTCACCGGATCCGCATCTTGAGACGGTGCGAGTGGAGGCATGGAGCGTAGGCTCGACGACCTGGGGCGTCACCCACAGATGA
AA sequence
>Lus10020128 pacid=23142040 polypeptide=Lus10020128 locus=Lus10020128.g ID=Lus10020128.BGIv1.0 annot-version=v1.0
MYFKLHNKSSSIPTNTSSKSHTLANRIPCPITLALTSPSSPATRPETPSTPPRQSTLPQFGDPFPPTVRPTHSSKHSAHAALPRIPIPSLRVFDPASRAA
ARAAPQQHSRLQVLATASRCQAAAGCTVPVAESVKSIRAVYNDSCSGIDPENYMVAAVSDELISEGFGCGTKFIITCVASSDNACLPSAQPITITVADDC
KPEPPRYEKCPTFVLSKQVYSAIANTDAGVEPSVTLACCRASHIPPYHPHLCHFLEAVGLLSIVDLVTLSPDPHLETVRVEAWSVGSTTWGVTHR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10020128 0 1
AT1G21430 YUC11 Flavin-binding monooxygenase f... Lus10000677 5.6 1.0000
AT2G15220 Plant basic secretory protein ... Lus10001608 7.9 1.0000
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10005144 9.6 1.0000
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10009630 10.2 1.0000
Lus10011605 11.4 1.0000
Lus10025268 13.5 1.0000
Lus10024141 13.6 1.0000
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10026232 14.4 1.0000
AT5G06720 ATPA2 peroxidase 2 (.1) Lus10027988 16.7 1.0000
Lus10013255 17.6 1.0000

Lus10020128 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.