Lus10020130 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 69 / 2e-15 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT4G30380 64 / 3e-13 EXLB2 Barwin-related endoglucanase (.1)
AT2G45110 49 / 5e-07 ATHEXPBETA1.1, ATEXPB4 expansin B4 (.1)
AT1G65681 44 / 2e-05 EXPB6 beta expansin 6 (.1)
AT1G65680 43 / 5e-05 ATHEXPBETA1.4, ATEXPB2 expansin B2 (.1)
AT3G45960 42 / 0.0002 ATHEXPBETA2.3, ATEXPL3, ATEXLA3 expansin-like A3 (.1.2)
AT4G38400 41 / 0.0002 ATEXPL2, ATHEXPBETA2.2, EXPL2, ATEXLA2 EXPANSIN L2, expansin-like A2 (.1)
AT3G45970 39 / 0.001 ATHEXPBETA2.1, ATEXPL1, ATEXLA1 EXPANSIN L1, expansin-like A1 (.1)
AT1G62980 39 / 0.001 ATHEXPALPHA1.25, ATEXP18, ATEXPA18 EXPANSIN 18, expansin A18 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026930 258 / 6e-88 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10026931 102 / 2e-26 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Lus10042435 83 / 3e-20 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10019978 82 / 4e-20 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10026929 72 / 3e-16 AT2G18660 53 / 1e-09 plant natriuretic peptide A (.1)
Lus10020126 69 / 8e-15 AT2G18660 57 / 7e-11 plant natriuretic peptide A (.1)
Lus10026232 67 / 7e-14 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10042436 62 / 5e-13 AT2G18660 53 / 2e-10 plant natriuretic peptide A (.1)
Lus10020125 63 / 8e-13 AT2G18660 63 / 2e-13 plant natriuretic peptide A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G218300 84 / 8e-21 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.006G176300 76 / 5e-18 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.006G179300 75 / 2e-17 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G101600 73 / 7e-17 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.018G098200 64 / 2e-13 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.018G031901 60 / 9e-12 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G155000 56 / 7e-10 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Potri.018G029100 54 / 1e-09 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G252200 54 / 2e-09 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.006G249500 54 / 2e-09 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10020130 pacid=23142035 polypeptide=Lus10020130 locus=Lus10020130.g ID=Lus10020130.BGIv1.0 annot-version=v1.0
ATGAGTAGTTTCCTGGTCGAAGCTAAGGTCCGCCGCACCCCACCATCTCCACCGGGAGCCGGAGCTCCAACTCCCACAGTAAAACCTCCTCGTCCTGGAC
AAATGCGGAATGCGACGGTTGGGAGGACCGGAACTGCTTCTTTCTCCGATCCCCCTTACACTCCATCTGCATGCCTTGAGGATAAGGAGCCAAAGAGTGT
AATGATTGCGGCAGCTGATCCTGCACTCTTTCGCAACGGCAAAGCTTGCGGGCAAATTTTCCAGGTGACATGCACTGGTGCTGCAGCCTCGGACGAACAA
CAACAAAGCTTGACGATGAAGAAAGACCCATCTCAAATTCAGAGTCCTTGCAAGAAAGGCGGTAAGCCCGTGGCGGTGACAGTTATAGACAGTTGCTCAC
CGACAGAGACAGATCCATGTCCTAGTTTGGTTTTGTCCAAAGAAGCATTTGCTGCCATCGCCAATCCTGACGCTGGTCTCATCACTATTTCCTTCCAACC
GTACGTCCATACATGTTTCATTATGATGATGTTGATACCTATTAAATACTATCTATTTCCTTTATTTTGA
AA sequence
>Lus10020130 pacid=23142035 polypeptide=Lus10020130 locus=Lus10020130.g ID=Lus10020130.BGIv1.0 annot-version=v1.0
MSSFLVEAKVRRTPPSPPGAGAPTPTVKPPRPGQMRNATVGRTGTASFSDPPYTPSACLEDKEPKSVMIAAADPALFRNGKACGQIFQVTCTGAAASDEQ
QQSLTMKKDPSQIQSPCKKGGKPVAVTVIDSCSPTETDPCPSLVLSKEAFAAIANPDAGLITISFQPYVHTCFIMMMLIPIKYYLFPLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10020130 0 1

Lus10020130 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.