Lus10020131 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 52 / 6e-09 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT4G30380 49 / 8e-08 EXLB2 Barwin-related endoglucanase (.1)
AT2G45110 50 / 1e-07 ATHEXPBETA1.1, ATEXPB4 expansin B4 (.1)
AT1G65681 45 / 5e-06 EXPB6 beta expansin 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026932 220 / 6e-74 AT2G18660 58 / 3e-11 plant natriuretic peptide A (.1)
Lus10042436 102 / 1e-28 AT2G18660 53 / 2e-10 plant natriuretic peptide A (.1)
Lus10020130 64 / 8e-13 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10042435 62 / 1e-12 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10026930 62 / 7e-12 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10026232 60 / 2e-11 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10026929 59 / 3e-11 AT2G18660 53 / 1e-09 plant natriuretic peptide A (.1)
Lus10019978 57 / 9e-11 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10026931 57 / 8e-10 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G098200 67 / 2e-14 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.006G179300 65 / 7e-14 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.003G218300 65 / 7e-14 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.018G101600 64 / 1e-13 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.018G029100 54 / 1e-09 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G176300 53 / 2e-09 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.006G252200 51 / 1e-08 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.018G031901 49 / 7e-08 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G249500 49 / 1e-07 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.006G155000 40 / 0.0002 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10020131 pacid=23141994 polypeptide=Lus10020131 locus=Lus10020131.g ID=Lus10020131.BGIv1.0 annot-version=v1.0
ATGGCAGCTGCTACTACTTGTCGCCTCAGCATCAATTCTTCCTCTCTTTTACCTCTTTTGGCTGCCTTCTTCCTCGCTATCTCCTTAAGCTTCACTTCTC
TTGCTTCCGCAGCTGGCAACGGAACTGCTTCCTCTTACCGCCCCGATGCTACATCAGCGTGCAAGAGCCACAACGGTTCAGCATCAATTAGTCAGACGCT
GGTTGCGATGGTTCCGAAGGCAGCATTTAATAACGGAGCAGCGTGCGGGAGGATGTACAAGATTAGTTGCATCGGAGCTATAGACGAATATCCAAAAGAA
CCCTGCAAACTTAATCAGTCGGTAACGGTGACCGTTGCCAATGAATGCGGCGGGGACGATTGTGCAACTTTTACATTGTCCACCGACGCTTACGCTTTAA
TTTCCAAACCTGATGCTGGTCGCATTCAGATCTCTTACAGACGATATCATAAAGGACAAAAGGCCATCCAGGATAGGAATGGTACTGACACAACCTGGAA
TATGATGTCTCACTGA
AA sequence
>Lus10020131 pacid=23141994 polypeptide=Lus10020131 locus=Lus10020131.g ID=Lus10020131.BGIv1.0 annot-version=v1.0
MAAATTCRLSINSSSLLPLLAAFFLAISLSFTSLASAAGNGTASSYRPDATSACKSHNGSASISQTLVAMVPKAAFNNGAACGRMYKISCIGAIDEYPKE
PCKLNQSVTVTVANECGGDDCATFTLSTDAYALISKPDAGRIQISYRRYHKGQKAIQDRNGTDTTWNMMSH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10020131 0 1
AT5G42800 M318, TT3, DFR dihydroflavonol 4-reductase (.... Lus10023096 5.2 0.7687
AT3G25180 CYP82G1 cytochrome P450, family 82, su... Lus10038203 6.2 0.7821
AT2G45560 CYP76C1 "cytochrome P450, family 76, s... Lus10027431 8.7 0.7442
AT1G23200 Plant invertase/pectin methyle... Lus10009110 16.8 0.7319
AT5G48290 Heavy metal transport/detoxifi... Lus10025182 20.2 0.7709
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10041290 22.0 0.6780
AT5G58770 Undecaprenyl pyrophosphate syn... Lus10038313 23.2 0.7562
AT5G18470 Curculin-like (mannose-binding... Lus10004765 40.5 0.7168
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10037792 44.0 0.6997
AT3G47570 Leucine-rich repeat protein ki... Lus10040186 44.4 0.7292

Lus10020131 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.