Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58590 99 / 2e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G31400 58 / 4e-11 GUN1 genomes uncoupled 1 (.1) AT3G53360 50 / 3e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G17140 48 / 1e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G29230 45 / 1e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G24000 44 / 2e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G06920 44 / 2e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G47460 44 / 3e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G68930 44 / 3e-06 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G08070 44 / 5e-06 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026937 [exp] 182 / 3e-55 AT3G58590 715 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022290 [exp] 56 / 2e-10 AT2G31400 911 / 0.0 genomes uncoupled 1 (.1) Lus10003657 [exp] 56 / 3e-10 AT2G31400 902 / 0.0 genomes uncoupled 1 (.1) Lus10022368 [exp] 54 / 2e-09 AT2G13600 414 / 2e-129 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10040997 [exp] 49 / 7e-08 AT4G13650 370 / 8e-116 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10027311 [exp] 49 / 1e-07 AT1G33350 621 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10000213 [exp] 49 / 1e-07 AT2G13600 435 / 8e-144 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10028953 [exp] 48 / 1e-07 AT5G47460 541 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10034408 [exp] 48 / 2e-07 AT5G42450 538 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G091000 [exp] 128 / 7e-36 AT3G58590 793 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G193900 [exp] 56 / 2e-10 AT2G31400 1192 / 0.0 genomes uncoupled 1 (.1) Potri.014G118500 [exp] 56 / 2e-10 AT2G31400 1213 / 0.0 genomes uncoupled 1 (.1) Potri.012G018800 [exp] 56 / 2e-10 AT2G13600 463 / 3e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.014G191200 [exp] 52 / 4e-09 AT5G48910 852 / 0.0 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G065500 [exp] 47 / 4e-07 AT5G06540 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.014G090400 [exp] 44 / 2e-06 AT5G28460 637 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G175900 [exp] 44 / 4e-06 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.009G113500 [exp] 44 / 4e-06 AT3G18840 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.004G047800 [exp] 44 / 5e-06 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10020137 pacid=23142007 polypeptide=Lus10020137 locus=Lus10020137.g ID=Lus10020137.BGIv1.0 annot-version=v1.0 ATGGGTTATGAAAATAATGAATATGTGTTCAGTGCCCTTCTTCCAAACTATGGGAGGGCAGGTCTCATCCATGAAGCAACAAAACTAGTAGCAGCATCTG AAATATTTGGTACGGTTCCTTCTAACACTATCGCTGGAATTTGCAACAGATCAGGCCAGTACCATGAAACACTTAAGTTGCTCTCACAGCTTGAAGAACC AGATCTTGTATCTTGGAATATTGTCCTTGCTGCTTGTGCTCGCAATGGTCATTACAAAGAGGCTATTGAGCTTTCACTGCTGTGCTTGCAGCTTGCAAAC ATGGTGGTTTAG
AA sequence Show only first row Show all	>Lus10020137 pacid=23142007 polypeptide=Lus10020137 locus=Lus10020137.g ID=Lus10020137.BGIv1.0 annot-version=v1.0 MGYENNEYVFSALLPNYGRAGLIHEATKLVAASEIFGTVPSNTIAGICNRSGQYHETLKLLSQLEEPDLVSWNIVLAACARNGHYKEAIELSLLCLQLAN MVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G58590			Pentatricopeptide repeat (PPR)...		Lus10020137 [exp]	0	1
AT2G35140			DCD (Development and Cell Deat...		Lus10018316 [exp]	13.3	0.7544
AT3G58590			Pentatricopeptide repeat (PPR)...		Lus10020138 [exp]	14.1	0.6937
AT5G32470			Haem oxygenase-like, multi-hel...		Lus10000819 [exp]	25.9	0.6773
AT1G50200		ACD, ALATS	Alanyl-tRNA synthetase (.1.2)		Lus10010210 [exp]	34.8	0.6981
AT5G49530			SIN-like family protein (.1)		Lus10024027 [exp]	47.1	0.6964
AT3G58590			Pentatricopeptide repeat (PPR)...		Lus10020139 [exp]	80.2	0.6431
AT3G07940			Calcium-dependent ARF-type GTP...		Lus10002760 [exp]	85.7	0.6510
AT5G64390		HEN4	HUA ENHANCER 4, RNA-binding KH...		Lus10028237 [exp]	87.9	0.6469
AT4G17090		CT-BMY, BMY8, B...	BETA-AMYLASE 8, BETA-AMYLASE 3...		Lus10040134 [exp]	91.0	0.6201
AT5G27680		RECQSIM	RECQ helicase SIM (.1)		Lus10019129 [exp]	132.8	0.6263

Compare expression of checked genes

Lus10020137 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.