Lus10020138 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G58590 164 / 1e-46 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G13600 123 / 2e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G33680 119 / 5e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21300 115 / 2e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G09040 115 / 2e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G26630 113 / 4e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G29760 113 / 1e-28 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G35130 112 / 2e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G13770 112 / 2e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G38010 111 / 3e-28 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026937 392 / 2e-133 AT3G58590 715 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10021232 125 / 5e-33 AT2G33680 818 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10035164 124 / 3e-32 AT3G02010 962 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10031994 122 / 9e-32 AT3G02010 957 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10009269 118 / 2e-30 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10019735 117 / 5e-30 AT4G33990 1015 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016425 113 / 9e-29 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10024199 113 / 1e-28 AT3G09040 1017 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10009913 113 / 1e-28 AT3G09040 1114 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G091000 235 / 4e-73 AT3G58590 793 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.008G052200 119 / 1e-30 AT2G39620 816 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G006800 119 / 1e-30 AT2G33680 780 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G187800 117 / 5e-30 AT3G09040 1201 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.008G093000 115 / 2e-29 AT1G69350 832 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G108000 113 / 7e-29 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.001G466066 112 / 2e-28 AT4G33990 1067 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G041200 112 / 2e-28 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G047800 112 / 2e-28 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G086900 112 / 2e-28 AT4G14850 964 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10020138 pacid=23142045 polypeptide=Lus10020138 locus=Lus10020138.g ID=Lus10020138.BGIv1.0 annot-version=v1.0
ATGCCAGTCAAGAGCTTGACCACATGGAATTCAATGATCTCTTGCTTTGCTAATCACGGCTTGGTTGAAGATATTATGATTCTGTTTCGTGACCTTTTAA
GCAAGGAAAGTATGATTCTGTTTCGTGACCTTTTAAGCAAGGAAAGTATATTATCTGAAGGCACGTTTGTTGGTCTTTTGTCCGGATTAGTATGCGATCA
AGATTTGGGATTTGGCCAGCAAGTGCATGGTTTAGCTATTAAAAATGGGTTTATGAGCAAGGTTCCAATTGCCAACAGTCTTGTTAATATGTATGTGAAA
TGTGGCAGCATGTCTCTGACCGAGAAAATGTTTCAGGATTTAAAGAACAAGGATATTGTGACGTGGAACACCCTGATTGGTGGATTAGTAAGAAATGGCA
ATGCCGACAAAGCAGCGGAGCTTTTCAAGAAACTCTCTAAAGATCTTCTCAGGCCTAATCAGGCGACATTTGTTAATCTCATCCAGTCATATACTGCTCT
ACAAATTCCGATGTTTGGGGAAGCTGTTCATGCTTTCATAATCATGCATGCTTCTGAAATGGATGCTTATTTTGGTAGTGCTCTAGTTGACTATTATGCT
AAGTGCAACAAGTTGGATGATGCATACAACTGTTTTCTTGAGATACGTGAAAAGAATGTAGTCTGA
AA sequence
>Lus10020138 pacid=23142045 polypeptide=Lus10020138 locus=Lus10020138.g ID=Lus10020138.BGIv1.0 annot-version=v1.0
MPVKSLTTWNSMISCFANHGLVEDIMILFRDLLSKESMILFRDLLSKESILSEGTFVGLLSGLVCDQDLGFGQQVHGLAIKNGFMSKVPIANSLVNMYVK
CGSMSLTEKMFQDLKNKDIVTWNTLIGGLVRNGNADKAAELFKKLSKDLLRPNQATFVNLIQSYTALQIPMFGEAVHAFIIMHASEMDAYFGSALVDYYA
KCNKLDDAYNCFLEIREKNVV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G58590 Pentatricopeptide repeat (PPR)... Lus10020138 0 1
AT1G31480 SGR2 shoot gravitropism 2 (SGR2) (.... Lus10002946 8.5 0.7848
AT3G58590 Pentatricopeptide repeat (PPR)... Lus10020139 10.5 0.7305
AT3G47840 Tetratricopeptide repeat (TPR)... Lus10019098 11.0 0.6786
AT3G50430 unknown protein Lus10022468 11.7 0.7845
AT3G58590 Pentatricopeptide repeat (PPR)... Lus10020137 14.1 0.6937
AT5G38520 alpha/beta-Hydrolases superfam... Lus10023788 14.8 0.7311
AT5G64390 HEN4 HUA ENHANCER 4, RNA-binding KH... Lus10028237 16.6 0.7294
AT4G02400 U3 ribonucleoprotein (Utp) fam... Lus10007881 18.9 0.7762
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Lus10042748 20.5 0.6952
AT5G01110 Tetratricopeptide repeat (TPR)... Lus10018113 21.1 0.7588

Lus10020138 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.