Lus10020139 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G58590 138 / 2e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G52850 79 / 1e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G24000 74 / 9e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G20770 71 / 9e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G41080 70 / 2e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G50420 68 / 7e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G13770 68 / 1e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G35130 67 / 1e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G30700 67 / 2e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53360 66 / 4e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026937 282 / 5e-92 AT3G58590 715 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027366 75 / 4e-16 AT2G40720 328 / 7e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10007840 70 / 3e-14 AT5G55740 579 / 0.0 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10038431 70 / 3e-14 AT4G20770 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10019731 69 / 8e-14 AT2G13600 436 / 3e-143 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10022125 68 / 9e-14 AT5G11490 1337 / 0.0 adaptin family protein (.1.2)
Lus10016772 67 / 1e-13 AT3G50420 256 / 7e-80 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10003324 67 / 2e-13 AT2G41080 597 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040504 67 / 2e-13 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G091000 172 / 1e-50 AT3G58590 793 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G131800 80 / 5e-18 AT3G50420 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G001200 75 / 3e-16 AT3G24000 798 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G047800 71 / 8e-15 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G258500 71 / 1e-14 AT2G40720 481 / 4e-157 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.012G108000 71 / 1e-14 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.013G129500 71 / 1e-14 AT5G09950 1001 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G144401 67 / 1e-14 AT2G34400 164 / 9e-49 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.001G064301 66 / 2e-14 AT2G34400 170 / 7e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.007G068600 69 / 5e-14 AT1G16480 1183 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10020139 pacid=23142061 polypeptide=Lus10020139 locus=Lus10020139.g ID=Lus10020139.BGIv1.0 annot-version=v1.0
ATGGGAGAGTTCGTTAAATGCCACCAGCGGCTGCTAAGTCTGCTAGAAGCCAGCTCAATAGTTCCTTCTCTTAGTGCGACTAAATGTCTTCACGCACTCT
CCATCAAACTTTACGACCCTTACTGCTCCCAAGCCACCTTTTTGCACAACAACATCATCTCTTTATACGCGTCGGTCAGGGAGTTGTGGACTGCACGTAA
GGTGTTTGACAGAATGCCGCAGAGGAACACGGCGTCCTACAATTCTATGATTTGTTGTTACAGCAGATTTGACTACTTGGATGATGCTTGTAGTACTCTT
AATCAGATGATGGCATCTGGATTTAGGCCTAATCAGTTCACTCTTGGGGGTCTCTTGTCGTGTGCGTCAATGGATATAAGTCTTGGGGTCAGATTGCAGG
GACTAGCAATGAAAAGCGGGTTGTTCTCTGTTGATGCTTTCGTGGGGACTTCTTTGTTGGGCTGTTTGGAAGGTCGGATTATTTAG
AA sequence
>Lus10020139 pacid=23142061 polypeptide=Lus10020139 locus=Lus10020139.g ID=Lus10020139.BGIv1.0 annot-version=v1.0
MGEFVKCHQRLLSLLEASSIVPSLSATKCLHALSIKLYDPYCSQATFLHNNIISLYASVRELWTARKVFDRMPQRNTASYNSMICCYSRFDYLDDACSTL
NQMMASGFRPNQFTLGGLLSCASMDISLGVRLQGLAMKSGLFSVDAFVGTSLLGCLEGRII

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G58590 Pentatricopeptide repeat (PPR)... Lus10020139 0 1
AT3G58590 Pentatricopeptide repeat (PPR)... Lus10020138 10.5 0.7305
AT5G15270 RNA-binding KH domain-containi... Lus10005232 20.6 0.7768
AT4G02400 U3 ribonucleoprotein (Utp) fam... Lus10007881 21.1 0.7670
AT5G27680 RECQSIM RECQ helicase SIM (.1) Lus10019129 29.3 0.7078
AT4G13750 EMB2597, NOV NO VEIN, EMBRYO DEFECTIVE 2597... Lus10016661 34.5 0.7643
AT1G31480 SGR2 shoot gravitropism 2 (SGR2) (.... Lus10002946 34.9 0.7426
AT5G01110 Tetratricopeptide repeat (TPR)... Lus10018113 37.5 0.7309
AT5G19485 transferases;nucleotidyltransf... Lus10026802 38.4 0.7004
AT4G04180 P-loop containing nucleoside t... Lus10040913 41.3 0.7115
AT3G50430 unknown protein Lus10022468 59.3 0.7222

Lus10020139 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.