Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45770 110 / 8e-31 Polyketide synthase, enoylreductase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G233300 [exp] 105 / 1e-28 AT3G45770 563 / 0.0 Polyketide synthase, enoylreductase family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020161 pacid=23141985 polypeptide=Lus10020161 locus=Lus10020161.g ID=Lus10020161.BGIv1.0 annot-version=v1.0 ATGACTGTGACGGCAGGCAATGCATATATAGATATAATAGCGTCTCGGTTACCCCCCGTGCAGGATCTTTCGCTGAAAGGGTTCTGGTTGCAGAATTGGC TGGGGAGTGACAAGACAAAGGAATGCAGGAAGATGGTAGATTACCTTCTGTCCCTAGCACAGCAAGGGAAGCTGAAATACGAGATGGAGCTGGTCCGTTT TGACAGTTTTGGTGTAGCATTGGATAAAGCACTTGGAAAGCTAGGGAGCCAGCCAAAACAAGTTATCATCTTCTAA
AA sequence Show only first row Show all	>Lus10020161 pacid=23141985 polypeptide=Lus10020161 locus=Lus10020161.g ID=Lus10020161.BGIv1.0 annot-version=v1.0 MTVTAGNAYIDIIASRLPPVQDLSLKGFWLQNWLGSDKTKECRKMVDYLLSLAQQGKLKYEMELVRFDSFGVALDKALGKLGSQPKQVIIF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G45770			Polyketide synthase, enoylredu...		Lus10020161 [exp]	0	1
AT2G22170			Lipase/lipooxygenase, PLAT/LH2...		Lus10037491 [exp]	3.2	0.8212
AT1G05780			Vacuolar ATPase assembly integ...		Lus10018982 [exp]	9.6	0.7307
AT4G02330		AtPME41, ATPMEP...	pectin methylesterase 41, Plan...		Lus10020679 [exp]	13.0	0.8404
AT1G05750		PDE247, CLB19	pigment defective 247, Tetratr...		Lus10001853 [exp]	13.4	0.7313
AT4G23020			unknown protein		Lus10029604 [exp]	13.9	0.7916
AT3G20970		ATNFU2, NFU4	ARABIDOPSIS THALIANA NFU DOMAI...		Lus10043440 [exp]	14.5	0.7724
AT1G18210			Calcium-binding EF-hand family...		Lus10042008 [exp]	14.8	0.7623
AT1G04640		LIP2	lipoyltransferase 2 (.1.2)		Lus10031225 [exp]	15.3	0.7914
AT1G63270		ABCI1, ATNAP10	ATP-binding cassette I1, non-i...		Lus10022692 [exp]	16.4	0.8196
AT4G26780		MGE2, AR192	mitochondrial GrpE 2, Co-chape...		Lus10032565 [exp]	20.7	0.7655

Compare expression of checked genes

Lus10020161 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.