Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31310 109 / 2e-31 AIG2-like (avirulence induced gene) family protein (.1) AT2G24390 100 / 7e-28 AIG2-like (avirulence induced gene) family protein (.1), AIG2-like (avirulence induced gene) family protein (.2), AIG2-like (avirulence induced gene) family protein (.3) AT3G28940 93 / 6e-25 AIG2-like (avirulence induced gene) family protein (.1) AT3G28930 90 / 2e-23 AIG2 AVRRPT2-INDUCED GENE 2, AIG2-like (avirulence induced gene) family protein (.1) AT5G39730 78 / 4e-19 AIG2-like (avirulence induced gene) family protein (.1) AT3G28950 77 / 2e-18 AIG2-like (avirulence induced gene) family protein (.1) AT5G39720 71 / 3e-16 AIG2L avirulence induced gene 2 like protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026984 [exp] 206 / 7e-67 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G003000 [exp] 131 / 8e-40 AT2G24390 191 / 8e-63 AIG2-like (avirulence induced gene) family protein (.1), AIG2-like (avirulence induced gene) family protein (.2), AIG2-like (avirulence induced gene) family protein (.3) Potri.006G278900 [exp] 130 / 2e-39 AT2G24390 194 / 4e-64 AIG2-like (avirulence induced gene) family protein (.1), AIG2-like (avirulence induced gene) family protein (.2), AIG2-like (avirulence induced gene) family protein (.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020179 pacid=23141970 polypeptide=Lus10020179 locus=Lus10020179.g ID=Lus10020179.BGIv1.0 annot-version=v1.0 ATGAAGTTGTTCGAGTCCTACTCAACCGCGTCCCTCACTCCTCCGCCGCTCTCCTCAATAGCTAATCCTGAACTACTAGTTCTCGATATCTTCGAGGATG TTGAATATGAGCGTCGCACTGTCGAAGTTTCCCTCCCGGAGGAGGAGAAGAAGCTACAAGTGTATGCCTATGTTTGGGGGAACAAGGACGATCCTGACTT GTACGGAGAATGGGATTTTGAGGAGTGGAAGAAAGCACACATGAGTGATTTTGTGAAGATGACAGCAGAATTCATGGAAGAATTGCAGCAACCAGATTCA AAGACGAGAGTGGCCACCTACGAATCTTACTATAACACAACACTAGTTACCACCGATAATGCCAGTAGTACTTCCACCGAGCCTTGA
AA sequence Show only first row Show all	>Lus10020179 pacid=23141970 polypeptide=Lus10020179 locus=Lus10020179.g ID=Lus10020179.BGIv1.0 annot-version=v1.0 MKLFESYSTASLTPPPLSSIANPELLVLDIFEDVEYERRTVEVSLPEEEKKLQVYAYVWGNKDDPDLYGEWDFEEWKKAHMSDFVKMTAEFMEELQQPDS KTRVATYESYYNTTLVTTDNASSTSTEP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31310			AIG2-like (avirulence induced ...		Lus10020179 [exp]	0	1
AT1G16470		PAB1	proteasome subunit PAB1 (.1.2)		Lus10017135 [exp]	4.5	0.8687
AT4G12310		CYP706A5	"cytochrome P450, family 706, ...		Lus10024580 [exp]	5.3	0.8758
AT5G06130			chaperone protein dnaJ-related...		Lus10016993 [exp]	14.0	0.7767
AT2G21150		XCT	XAP5 CIRCADIAN TIMEKEEPER, XAP...		Lus10012170 [exp]	21.8	0.8661
AT5G59140			BTB/POZ domain-containing prot...		Lus10016485 [exp]	25.0	0.8367
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10023850 [exp]	29.3	0.8486
AT2G38900			Serine protease inhibitor, pot...		Lus10035626 [exp]	30.7	0.8437
					Lus10039025 [exp]	34.7	0.8489
AT4G31720		STG1, TAFII15, ...	TBP-ASSOCIATED FACTOR 10, SALT...		Lus10034375 [exp]	36.4	0.8520
AT4G22380			Ribosomal protein L7Ae/L30e/S1...		Lus10025435 [exp]	37.2	0.8307

Compare expression of checked genes

Lus10020179 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.