Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31300 416 / 1e-149 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G40580 103 / 1e-26 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT3G27430 102 / 4e-26 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G13060 89 / 9e-21 PBE1 20S proteasome beta subunit E1 (.1.2) AT3G26340 81 / 4e-18 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT4G14800 55 / 4e-09 PBD2 20S proteasome beta subunit D2 (.1.2) AT3G22630 53 / 2e-08 PRCGB, PBD1 20S proteasome beta subunit D1 (.1) AT3G22110 48 / 2e-06 PAC1 20S proteasome alpha subunit C1 (.1) AT1G53850 44 / 4e-05 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT3G14290 44 / 5e-05 PAE2 20S proteasome alpha subunit E2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026984 [exp] 369 / 4e-129 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10014581 [exp] 108 / 8e-28 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3) Lus10032102 [exp] 105 / 3e-27 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10006426 [exp] 80 / 2e-17 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10011369 [exp] 79 / 4e-17 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10041194 [exp] 60 / 1e-10 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1) Lus10039351 [exp] 57 / 7e-10 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1) Lus10042145 [exp] 48 / 2e-06 AT3G22110 474 / 3e-172 20S proteasome alpha subunit C1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G077900 [exp] 390 / 2e-139 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.018G145900 [exp] 389 / 6e-139 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.017G071100 [exp] 102 / 6e-26 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3) Potri.004G066000 [exp] 100 / 2e-25 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.010G058100 [exp] 84 / 3e-19 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.008G177000 [exp] 81 / 4e-18 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.016G015400 [exp] 50 / 2e-07 AT3G22110 445 / 1e-160 20S proteasome alpha subunit C1 (.1) Potri.006G008800 [exp] 47 / 3e-06 AT3G22110 452 / 1e-163 20S proteasome alpha subunit C1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [flax] [poplar] NTN PF00227 [flax] [poplar] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Lus10020180 pacid=23141981 polypeptide=Lus10020180 locus=Lus10020180.g ID=Lus10020180.BGIv1.0 annot-version=v1.0 ATGGATACGTGTATCAGCGATCTGAATGCTCCCCACTCGATGGGCACCACCATCATCGGCGTCACCTACAACGGCGGCGTCATTCTCGGCGCTGATTCCC GAACCAGCACCGGAATGTATGTTGCTAACAGGGCTTCGGACAAGATTACCCAGCTCACTGATAACGTCTACGTCTGTCGCTCTGGATCGGCTGCAGATTC CCAGATTGTTTCTGACTATGTCCGATACTTCTTGCACCAACACACAATACAATTAGGACAGCCTTCAACTGTCAAGGTTGCTGCAAATCTTGTCCGCCTA CTGTCATACAATAACAAGAACAATCTACAAACTGGTCTCATCATTGGTGGATGGGACAAGTATGAAGGTGGGAAAATTTATGGAGTCCCTCTTGGTGGAA CGTTGATTGAGGCACCCTTTGCTATTGGAGGATCTGGTTCCAGTTACTTATATGGGTTCTTTGATCAAGTTTGGAAAGATGGCATGACCAAAGAGGAAGC AGAGCAATTAGTGGTGAAGGCAGTTTCCCTAGCCATTGCAAGAGATGGTGCAAGTGGTGGTGTTGTCCGCACTGTGGTTATAAATTCAGAGGGAGTGACA AGAAACTGCTACCCAGGGGACACATTGCCGCTGTGGCATGAGGAGCTGGAGCCACAGAATTCACTGCTGGACATACTCAATGCACAAGGACAGAGTCCTG AGCCAATGAACATATGA
AA sequence Show only first row Show all	>Lus10020180 pacid=23141981 polypeptide=Lus10020180 locus=Lus10020180.g ID=Lus10020180.BGIv1.0 annot-version=v1.0 MDTCISDLNAPHSMGTTIIGVTYNGGVILGADSRTSTGMYVANRASDKITQLTDNVYVCRSGSAADSQIVSDYVRYFLHQHTIQLGQPSTVKVAANLVRL LSYNNKNNLQTGLIIGGWDKYEGGKIYGVPLGGTLIEAPFAIGGSGSSYLYGFFDQVWKDGMTKEEAEQLVVKAVSLAIARDGASGGVVRTVVINSEGVT RNCYPGDTLPLWHEELEPQNSLLDILNAQGQSPEPMNI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31300		PBA1	N-terminal nucleophile aminohy...		Lus10020180 [exp]	0	1
AT5G42790		ARS5, ATPSM30, ...	ARSENIC TOLERANCE 5, proteasom...		Lus10024269 [exp]	1.0	0.9102
AT3G26400		EIF4B1	eukaryotic translation initiat...		Lus10036874 [exp]	6.3	0.8350
AT4G02580			NADH-ubiquinone oxidoreductase...		Lus10018762 [exp]	6.9	0.7898
AT5G58290		RPT3	regulatory particle triple-A A...		Lus10006854 [exp]	7.5	0.8598
AT4G22670		ATHIP1, TPR11	tetratricopeptide repeat 11, H...		Lus10032227 [exp]	8.8	0.8425
AT4G12340			copper ion binding (.1)		Lus10032225 [exp]	12.0	0.8233
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10041288 [exp]	16.5	0.7985
AT3G48680		AtCAL2, GAMMACA...	gamma carbonic anhydrase-like ...		Lus10031278 [exp]	17.3	0.8325
AT2G20140		RPT2b	regulatory particle AAA-ATPase...		Lus10022834 [exp]	18.2	0.7496
AT2G32450			Calcium-binding tetratricopept...		Lus10010627 [exp]	22.2	0.7862

Compare expression of checked genes

Lus10020180 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.