Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24370 238 / 2e-73 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT4G31230 205 / 5e-61 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G78940 182 / 9e-53 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) AT1G16760 174 / 8e-50 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G35380 164 / 3e-46 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT3G20200 159 / 3e-44 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT2G07020 157 / 5e-44 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G20310 138 / 2e-38 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G17540 121 / 3e-31 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G72760 116 / 2e-29 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026989 [exp] 400 / 4e-135 AT2G24370 1014 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10035711 [exp] 155 / 2e-46 AT1G16760 205 / 2e-61 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10027592 [exp] 154 / 4e-46 AT3G20200 175 / 2e-50 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10033340 [exp] 159 / 2e-44 AT1G16760 800 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10008542 [exp] 155 / 4e-43 AT2G24370 823 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10037298 [exp] 155 / 5e-43 AT1G16760 820 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10021596 [exp] 152 / 6e-42 AT2G24370 828 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10042205 [exp] 149 / 6e-41 AT1G16760 691 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10008609 [exp] 148 / 6e-41 AT1G16760 417 / 3e-137 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G002400 [exp] 224 / 2e-68 AT2G24370 956 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.004G170901 [exp] 184 / 5e-54 AT1G78940 584 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.004G170742 [exp] 184 / 3e-53 AT1G78940 786 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.014G001700 [exp] 171 / 2e-48 AT1G78940 783 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.007G001900 [exp] 170 / 3e-48 AT1G78940 757 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.006G078500 [exp] 127 / 4e-33 AT2G24370 824 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.001G198300 [exp] 126 / 1e-32 AT5G12000 639 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.018G061600 [exp] 123 / 9e-32 AT5G12000 714 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.018G147200 [exp] 114 / 3e-29 AT5G20310 162 / 1e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.006G225300 [exp] 113 / 2e-28 AT5G12000 749 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10020184 pacid=23141992 polypeptide=Lus10020184 locus=Lus10020184.g ID=Lus10020184.BGIv1.0 annot-version=v1.0 ATGTGGATGCCAAGAACAGTAACAACAACAGAAAGGAAGGAAGCAGGGAATGGAGTGGTGGCCGTGGCAATAGATAAGGACAAAACAAGCCAAGCTGCTC TCAAATGGGCTATCGACACCATTCTCCAAAGGGGTCAAACCCTCATTCTCATCCATGTCAAGCTTAAGCCTCAATCCTCCTCCACTTCTGCTCCTCGAAT GAATCAAGTCATAGATGCTAACGGTGAAAGCCCGTTGGTATGCAAAAACCCTGACGCAGCAACCAAAGACATGTTCTTGCCTTTTCGATGCTTCTGCACC CGTAAAGATATTCAATGTCAAGACATAGTGTTGGAAGATTCAGATGTAGCGAAAGCATTGACCGAGTATGCCACTCAGATGGCCATCGAGACTTTGGTAT TGGGCGCCACTTCAAAAGGTGGCTTTCTCAGATTCAGGGCGACGGACATACCTACAAGCGTGTCGAAAGGGGCACCTGATTTTTGTACAGTGTATGTGAT TTCCAAAGGCAAAATCCAGTCTGCAAGATCTGCTTCCCGTCCTGCACCTGCCATCTCTCCTTTCCGCAACATCTCTAGCCAACCCAGCATCAAGCCCAAT GTCTCTGAACCTCCAACTGCTGCTCAACAAGCACCTACCAAACGTATTGAGAGGCCACCAATTGAGCAACCACGAAGATCAGTTGATCAGCAGCAACAGC GGAGATCAAATGATCAACAAAGAAGATCAACTGATGGTACTGCCGATTTTTTCAGGTCGGTGACTTAA
AA sequence Show only first row Show all	>Lus10020184 pacid=23141992 polypeptide=Lus10020184 locus=Lus10020184.g ID=Lus10020184.BGIv1.0 annot-version=v1.0 MWMPRTVTTTERKEAGNGVVAVAIDKDKTSQAALKWAIDTILQRGQTLILIHVKLKPQSSSTSAPRMNQVIDANGESPLVCKNPDAATKDMFLPFRCFCT RKDIQCQDIVLEDSDVAKALTEYATQMAIETLVLGATSKGGFLRFRATDIPTSVSKGAPDFCTVYVISKGKIQSARSASRPAPAISPFRNISSQPSIKPN VSEPPTAAQQAPTKRIERPPIEQPRRSVDQQQQRRSNDQQRRSTDGTADFFRSVT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G24370			Protein kinase protein with ad...		Lus10020184 [exp]	0	1
AT2G24370			Protein kinase protein with ad...		Lus10020185 [exp]	8.4	0.5733
AT3G19610			Plant protein of unknown funct...		Lus10002129 [exp]	9.2	0.5997
AT3G45740			hydrolase family protein / HAD...		Lus10001969 [exp]	14.4	0.6072
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10033877 [exp]	19.9	0.5690
AT5G03300		ADK2	adenosine kinase 2 (.1)		Lus10023197 [exp]	28.1	0.5186
AT5G36930			Disease resistance protein (TI...		Lus10026707 [exp]	45.0	0.5177
AT1G29195			unknown protein		Lus10002327 [exp]	45.2	0.5526
AT1G09600			Protein kinase superfamily pro...		Lus10008925 [exp]	61.2	0.5395
AT1G09330		ECHIDNA, ECH	unknown protein		Lus10031433 [exp]	84.2	0.4691
AT4G33280	B3	REM16	AP2/B3-like transcriptional fa...		Lus10032872 [exp]	102.4	0.5226

Compare expression of checked genes

Lus10020184 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.