Lus10020194 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006041 61 / 8e-12 ND /
Lus10020402 56 / 6e-11 ND /
Lus10022417 45 / 3e-06 AT3G49210 68 / 1e-13 O-acyltransferase (WSD1-like) family protein (.1)
Lus10022081 43 / 2e-05 AT1G20960 218 / 1e-68 embryo defective 1507, U5 small nuclear ribonucleoprotein helicase, putative (.1.2)
Lus10030094 42 / 2e-05 ND /
Lus10009393 0 / 1 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10020194 pacid=23141964 polypeptide=Lus10020194 locus=Lus10020194.g ID=Lus10020194.BGIv1.0 annot-version=v1.0
ATGAGCAGCTCTGTTGGGGGTGCTGGGAACCACCATGATCCGAATGCGGGGACAGGCCGTAAAAAAGGAGAGAATCTCAGCGATAATAGCTCTACCGACA
ATGCATCGTGTGCAACTCCAAGAGATCCGGGAAAGCACCGTCTATGCATCCTCTTCAAGGTCCACCTGTTAGACCCCATGTTGAAAGCACCAGACACAAC
CGTCGTGGACTGCAAGAAGCTCCAATACATAAGGGTCAAGGAGCTCTGGGTACTGGGTATTGCTTGTGCTTTGGCTATGAATGAAGAAGTTAGTGCAATA
ACCTGCGAAGCTGAAAATGAACCTGAACTTGGTGATGATGGTGAACCTTATACAGATGATATGGATGACGATTGGATTGGCATCATACCATGTGACAACA
AAGATGATGAGTAA
AA sequence
>Lus10020194 pacid=23141964 polypeptide=Lus10020194 locus=Lus10020194.g ID=Lus10020194.BGIv1.0 annot-version=v1.0
MSSSVGGAGNHHDPNAGTGRKKGENLSDNSSTDNASCATPRDPGKHRLCILFKVHLLDPMLKAPDTTVVDCKKLQYIRVKELWVLGIACALAMNEEVSAI
TCEAENEPELGDDGEPYTDDMDDDWIGIIPCDNKDDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10020194 0 1
AT1G09080 BIP3 binding protein 3, Heat shock ... Lus10013055 1.0 0.9969
Lus10014195 1.4 0.9952
Lus10010397 3.0 0.9874
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10006244 4.0 0.9767
AT2G16460 Protein of unknown function (D... Lus10041812 6.3 0.9705
Lus10042024 7.2 0.9525
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10002774 7.3 0.9687
AT5G13825 unknown protein Lus10000042 7.9 0.9670
AT1G68310 AE7 AS1/2 ENHANCER7, Protein of un... Lus10031007 8.9 0.9667
Lus10002411 9.0 0.9651

Lus10020194 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.