Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65295 112 / 3e-33 unknown protein AT5G01015 61 / 3e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026997 [exp] 197 / 1e-66 AT1G65295 113 / 9e-34 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G053100 [exp] 126 / 7e-39 AT1G65295 123 / 1e-37 unknown protein Potri.006G113700 [exp] 72 / 3e-17 AT5G01015 71 / 9e-17 unknown protein Potri.016G143400 [exp] 56 / 7e-11 AT5G01015 56 / 4e-11 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020197 pacid=23141989 polypeptide=Lus10020197 locus=Lus10020197.g ID=Lus10020197.BGIv1.0 annot-version=v1.0 ATGTCTGCCTACAGTCAAAGCCTCGCTGTTTCTCTCTTTACCCTTCTTCTTCTTTCATCTTCCGTCATCAGATTCAGTGAAGCATCAAATGGAGTTCAAG TGATGGAATCGACGATGGAGCCGGTGAAGATGGTGGAGATGAGATTGATGTTGAACGATAGCAGGAGGAGACTCAACAGCTTCCAGATGTGTGCGCTATG CACTTGCTGCGGTGGCGGTGCTTCTAAACGTTACTGTTTGCCATCACCTTGTTGCTACGCCATAAATTGCAACATTCCAAACAGGCCCTTTGGTTACTGC TCTTTCACTCCCAAGGCCTGCAATTGCTTTGGATGCCATCTCTAG
AA sequence Show only first row Show all	>Lus10020197 pacid=23141989 polypeptide=Lus10020197 locus=Lus10020197.g ID=Lus10020197.BGIv1.0 annot-version=v1.0 MSAYSQSLAVSLFTLLLLSSSVIRFSEASNGVQVMESTMEPVKMVEMRLMLNDSRRRLNSFQMCALCTCCGGGASKRYCLPSPCCYAINCNIPNRPFGYC SFTPKACNCFGCHL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65295			unknown protein		Lus10020197 [exp]	0	1
AT1G65295			unknown protein		Lus10026997 [exp]	1.0	0.8649
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10024649 [exp]	2.0	0.8376
AT4G13540			unknown protein		Lus10004393 [exp]	3.9	0.8158
AT5G66090			unknown protein		Lus10041868 [exp]	6.0	0.7994
AT5G40500			unknown protein		Lus10022273 [exp]	9.6	0.8124
AT4G03400		GH3-10, DFL2	DWARF IN LIGHT 2, Auxin-respon...		Lus10039797 [exp]	17.6	0.8100
AT2G14045			unknown protein		Lus10022007 [exp]	18.2	0.7564
AT3G18050			unknown protein		Lus10027253 [exp]	21.2	0.7701
AT2G32580			Protein of unknown function (D...		Lus10035349 [exp]	22.6	0.7954
AT1G35180			TRAM, LAG1 and CLN8 (TLC) lipi...		Lus10010635 [exp]	24.1	0.7870

Compare expression of checked genes

Lus10020197 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.