Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006458 [exp] 126 / 6e-39 ND 37 / 0.003 Lus10001729 [exp] 100 / 3e-26 AT5G55390 622 / 0.0 ENHANCED DOWNY MILDEW 2 (.1.2) Lus10002269 [exp] 89 / 2e-23 AT5G55390 174 / 8e-50 ENHANCED DOWNY MILDEW 2 (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020204 pacid=23141954 polypeptide=Lus10020204 locus=Lus10020204.g ID=Lus10020204.BGIv1.0 annot-version=v1.0 ATGAAGAAGCTGATGGAAGACTCGGCTCTGCTGAGTATGAGAAGAGAGAATGCCAAGATTTTGGAGAGAGCCCGTAAGGCTGGACATCACCACCGGATTC ACCAAGTCTCTCACGTTTGGATCCATCGAGAACTATGTCCAGTCCAGGCTGTTCATACCGCTAAAGAATCTCTAGATAACAACGGCAGTATTGACGACGC TCTAGCTGTTTCCCCAAGAGAGACTCTGACCAGTCTATACCAATGGGATTCAGTTGGTTAA
AA sequence Show only first row Show all	>Lus10020204 pacid=23141954 polypeptide=Lus10020204 locus=Lus10020204.g ID=Lus10020204.BGIv1.0 annot-version=v1.0 MKKLMEDSALLSMRRENAKILERARKAGHHHRIHQVSHVWIHRELCPVQAVHTAKESLDNNGSIDDALAVSPRETLTSLYQWDSVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10020204 [exp]	0	1
					Lus10031413 [exp]	4.9	0.6874
					Lus10040759 [exp]	7.3	0.6959
AT5G20260			Exostosin family protein (.1)		Lus10027707 [exp]	8.5	0.6136
AT1G10710		PHS1	poor homologous synapsis 1 (.1...		Lus10042079 [exp]	16.9	0.6497
AT3G15280			unknown protein		Lus10009211 [exp]	17.3	0.5463
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Lus10011662 [exp]	25.3	0.6422
AT4G19820			Glycosyl hydrolase family prot...		Lus10036315 [exp]	30.8	0.5564
AT5G59720		HSP18.2 HSP18.1...	heat shock protein 18.2 (.1)		Lus10022314 [exp]	31.3	0.5765
					Lus10014248 [exp]	31.3	0.6128
AT5G42230		SCPL41	serine carboxypeptidase-like 4...		Lus10023444 [exp]	41.5	0.6098

Compare expression of checked genes

Lus10020204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.