Lus10020211 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16450 104 / 3e-29 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1.2)
AT3G02770 87 / 1e-22 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1)
AT5G56260 86 / 9e-22 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020212 252 / 2e-87 AT5G16450 299 / 1e-105 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1.2)
Lus10026835 218 / 7e-74 AT5G16450 299 / 1e-105 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1.2)
Lus10027126 79 / 3e-19 AT5G56260 278 / 2e-97 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1)
Lus10032885 72 / 1e-16 AT5G56260 279 / 9e-98 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G085700 134 / 4e-41 AT5G16450 282 / 5e-99 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1.2)
Potri.019G053800 128 / 2e-38 AT5G16450 292 / 5e-103 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1.2)
Potri.011G169700 85 / 1e-21 AT5G56260 265 / 3e-92 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1)
PFAM info
Representative CDS sequence
>Lus10020211 pacid=23141948 polypeptide=Lus10020211 locus=Lus10020211.g ID=Lus10020211.BGIv1.0 annot-version=v1.0
ATGAGAAGCCAGAGCTCGAATCCCAATATCACATCCGTTGATCTCATCAACATCCCTTATGCATCCATTCACAACAATCCCAGCCCATCCATTGTTCTGA
GCTTGAACCACAGGGTTCCCTCCCAGGATTGCGCACCTCAAACTGCCACCACCATCCACAACAAGGACTCTGCCGTTGCCCTTTTCTTCCAGGAACTCGC
GGATCAGGACATTGTCTTCGAACACCTTGAGGGTGACGACTGGCCCGCTGAAGACCTGGCGGCGACCGTATATCTGGAAGATTGGCTGGAGTGCCCTGAG
CTCACCGCTGACGATCAGCTGAGGGTTTGCATCACAGACTTCGGCAGTTGTGACCAGTGCCATCTGTTTTTAATCACAAGGGTACAAGGGCATCATCATA
CAGAATACAAGAAGGGTATCAGAGAAGCATAA
AA sequence
>Lus10020211 pacid=23141948 polypeptide=Lus10020211 locus=Lus10020211.g ID=Lus10020211.BGIv1.0 annot-version=v1.0
MRSQSSNPNITSVDLINIPYASIHNNPSPSIVLSLNHRVPSQDCAPQTATTIHNKDSAVALFFQELADQDIVFEHLEGDDWPAEDLAATVYLEDWLECPE
LTADDQLRVCITDFGSCDQCHLFLITRVQGHHHTEYKKGIREA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10020211 0 1
AT5G22900 ATCHX3 cation/H+ exchanger 3, ARABIDO... Lus10040961 6.3 0.7236
AT2G22910 NAGS1 N-acetyl-l-glutamate synthase ... Lus10012093 17.6 0.7254
AT1G20823 RING/U-box superfamily protein... Lus10013210 19.6 0.7206
AT4G27220 NB-ARC domain-containing disea... Lus10008516 20.3 0.7294
AT3G22530 unknown protein Lus10035239 24.5 0.6776
Lus10024718 25.7 0.7159
AT1G33560 ADR1 ACTIVATED DISEASE RESISTANCE 1... Lus10032759 30.6 0.7076
AT5G40060 Disease resistance protein (NB... Lus10002248 50.8 0.7135
AT5G65520 Tetratricopeptide repeat (TPR)... Lus10016283 65.3 0.6695
AT2G46150 Late embryogenesis abundant (L... Lus10036403 67.5 0.7009

Lus10020211 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.