Lus10020212 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16450 299 / 9e-106 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1.2)
AT3G02770 297 / 9e-105 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1)
AT5G56260 244 / 4e-84 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026835 336 / 3e-120 AT5G16450 299 / 1e-105 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1.2)
Lus10032885 256 / 2e-88 AT5G56260 279 / 9e-98 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1)
Lus10027126 254 / 5e-88 AT5G56260 278 / 2e-97 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1)
Lus10020211 243 / 9e-84 ND 225 / 8e-77
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G053800 324 / 1e-115 AT5G16450 292 / 5e-103 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1.2)
Potri.013G085700 313 / 2e-111 AT5G16450 282 / 5e-99 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1.2)
Potri.011G169700 251 / 1e-86 AT5G56260 265 / 3e-92 Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0364 Leu-IlvD PF03737 RraA-like Aldolase/RraA
Representative CDS sequence
>Lus10020212 pacid=23142000 polypeptide=Lus10020212 locus=Lus10020212.g ID=Lus10020212.BGIv1.0 annot-version=v1.0
ATGGCACTGGTCACAACTGCCGAAGTCTGTGATGCAAACCCTCAGCTGATCGTCAGCGGTGAGCTCAGGGCACTCCAGCCAATCTTCCAGATATACGGTC
GCCGCCAGGTCTTCAGCGGGCCAGTCGTCACCCTCAAGGTGTTCGAAGACAATGTCCTGATCCGCGAGTTCCTGGAAGAAAAGGGCAACGGCAGAGTCCT
TGTTGTGGATGGTGGTGGCAGTTTGAGGTGCGCAATCCTGGGAGGGAACCCTGTGGTTCAAGCTCAGAACAATGGATGGGCTGGGATTGTTGTGAATGGA
TGCATAAGGGATGTTGATGAGATCAACGGATGTGATATTGGGATTCGAGCTCTGGCTTCTCATCCCATGAAAGCTAACAAGAAAGGAATTGGGGAGAAGC
ACGTCCCTGTCACTGTTGCTGGGACTAGGATCTGTGATGGAGATTGGCTTTATGCTGATACTGATGGCATCCTTATCTCTCGAACCGAGTTGTCTGTCTG
A
AA sequence
>Lus10020212 pacid=23142000 polypeptide=Lus10020212 locus=Lus10020212.g ID=Lus10020212.BGIv1.0 annot-version=v1.0
MALVTTAEVCDANPQLIVSGELRALQPIFQIYGRRQVFSGPVVTLKVFEDNVLIREFLEEKGNGRVLVVDGGGSLRCAILGGNPVVQAQNNGWAGIVVNG
CIRDVDEINGCDIGIRALASHPMKANKKGIGEKHVPVTVAGTRICDGDWLYADTDGILISRTELSV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G16450 Ribonuclease E inhibitor RraA/... Lus10020212 0 1
AT4G12080 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localize... Lus10000381 7.1 0.6738
AT1G29970 RPL18AA 60S ribosomal protein L18A-1 (... Lus10028130 11.1 0.6701
AT1G67340 HCP-like superfamily protein w... Lus10006418 12.6 0.6726
Lus10003030 36.2 0.6445
AT2G31800 Integrin-linked protein kinase... Lus10008350 56.9 0.5865
AT1G18530 EF hand calcium-binding protei... Lus10038953 80.5 0.5509
AT5G18140 Chaperone DnaJ-domain superfam... Lus10020286 86.7 0.5702
AT4G35090 CAT2 catalase 2 (.1.2) Lus10016017 97.7 0.5755
AT1G55365 unknown protein Lus10013409 126.3 0.5546
AT1G31320 AS2 LBD4 LOB domain-containing protein ... Lus10031191 135.6 0.5379

Lus10020212 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.