Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65290 183 / 4e-61 MTACP2 mitochondrial acyl carrier protein 2 (.1) AT2G44620 126 / 1e-38 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1) AT5G47630 85 / 6e-22 MTACP3 mitochondrial acyl carrier protein 3 (.1.2) AT5G36280 62 / 7e-14 unknown protein AT1G54580 62 / 3e-13 ACP2 acyl carrier protein 2 (.1) AT1G54630 59 / 6e-12 ACP3 acyl carrier protein 3 (.1.2) AT5G27200 57 / 4e-11 ACP5 acyl carrier protein 5 (.1) AT3G05020 57 / 4e-11 ACP1 acyl carrier protein 1 (.1) AT4G25050 51 / 5e-09 ACP4 acyl carrier protein 4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026849 [exp] 267 / 9e-88 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3) Lus10019500 [exp] 126 / 2e-38 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10043348 [exp] 126 / 2e-38 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10038782 [exp] 87 / 6e-23 AT5G47630 112 / 6e-33 mitochondrial acyl carrier protein 3 (.1.2) Lus10000050 [exp] 86 / 1e-22 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10039077 [exp] 86 / 1e-22 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10037910 [exp] 54 / 5e-10 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2) Lus10037908 [exp] 54 / 7e-10 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2) Lus10033836 [exp] 54 / 7e-10 AT4G25050 137 / 2e-42 acyl carrier protein 4 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G055300 [exp] 211 / 3e-72 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1) Potri.013G084500 [exp] 205 / 1e-69 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1) Potri.014G044000 [exp] 115 / 4e-34 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1) Potri.002G135600 [exp] 105 / 4e-30 AT2G44620 177 / 1e-58 mitochondrial acyl carrier protein 1 (.1) Potri.016G006300 [exp] 88 / 2e-23 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2) Potri.006G005700 [exp] 87 / 4e-23 AT5G47630 107 / 5e-31 mitochondrial acyl carrier protein 3 (.1.2) Potri.005G044800 [exp] 55 / 2e-10 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1) Potri.006G217800 [exp] 55 / 2e-10 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2) Potri.013G031300 [exp] 53 / 1e-09 AT3G05020 142 / 1e-44 acyl carrier protein 1 (.1) Potri.015G104500 [exp] 51 / 8e-09 AT4G25050 122 / 2e-36 acyl carrier protein 4 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0314 [flax] [poplar] PP-binding PF00550 [flax] [poplar] PP-binding Phosphopantetheine attachment site
Representative CDS sequence Show only first row Show all	>Lus10020221 pacid=23142070 polypeptide=Lus10020221 locus=Lus10020221.g ID=Lus10020221.BGIv1.0 annot-version=v1.0 ATGGCAGCGGCCAGAGGAATTTTGCTCAAGCACCTCCGAGTTAAGGTGCAACCCTTACCCCAAATCCCTAACACCAGCAATGGCCTCTTCGGTCTCTCTT TCAATTCCGTTCTGCGCCGATTCTCGGAGGAGGTTAAGGGCAACTTCCTTGACAAATCGGAAGTCACAGATCGTGTCGTCAATTGTGTCAAGAACTTCCA GAAGGTTGATGCCTCCAAGGTAACCACCAATGCTCATTTCCAGAATGACCTTGGGTTGGATAGTTTAGATACGGTGGAGATTGTGATGGCCCTTGAAGAA GAGTTTGGATTCGAGATACCAGATAATGAAGCAGACAAGATCAATACTATCAGTCTTGCTGTGGACTATATAGCTTCACACCCTCAAGCAAAGTAG
AA sequence Show only first row Show all	>Lus10020221 pacid=23142070 polypeptide=Lus10020221 locus=Lus10020221.g ID=Lus10020221.BGIv1.0 annot-version=v1.0 MAAARGILLKHLRVKVQPLPQIPNTSNGLFGLSFNSVLRRFSEEVKGNFLDKSEVTDRVVNCVKNFQKVDASKVTTNAHFQNDLGLDSLDTVEIVMALEE EFGFEIPDNEADKINTISLAVDYIASHPQAK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65290		MTACP2	mitochondrial acyl carrier pro...		Lus10020221 [exp]	0	1
AT5G62270			unknown protein		Lus10021682 [exp]	1.4	0.8831
AT5G49210			unknown protein		Lus10036792 [exp]	3.9	0.8356
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10014277 [exp]	5.2	0.8271
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10031085 [exp]	8.9	0.8662
AT1G11840		ATGLX1	glyoxalase I homolog (.1.2.3.4...		Lus10003523 [exp]	11.0	0.8353
AT5G27660			Trypsin family protein with PD...		Lus10017093 [exp]	11.5	0.8156
AT2G34520		RPS14	mitochondrial ribosomal protei...		Lus10034657 [exp]	12.4	0.8409
AT1G23100			GroES-like family protein (.1)		Lus10036055 [exp]	17.4	0.8385
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Lus10036786 [exp]	20.8	0.8114
AT2G33220			GRIM-19 protein (.1)		Lus10023693 [exp]	24.7	0.8029

Compare expression of checked genes

Lus10020221 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.