Lus10020234 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G36890 217 / 2e-69 BGLU42 beta glucosidase 42 (.1.2)
AT3G18070 150 / 2e-44 BGLU43 beta glucosidase 43 (.1.2)
AT3G18080 143 / 8e-41 BGLU44 B-S glucosidase 44 (.1)
AT5G54570 141 / 4e-40 BGLU41 beta glucosidase 41 (.1)
AT3G60130 139 / 9e-40 BGLU16 beta glucosidase 16 (.1.2.3)
AT1G26560 138 / 6e-39 BGLU40 beta glucosidase 40 (.1)
AT2G44480 135 / 1e-38 BGLU17 beta glucosidase 17 (.1.2)
AT2G44450 136 / 2e-38 BGLU15 beta glucosidase 15 (.1)
AT5G24540 135 / 5e-38 BGLU31 beta glucosidase 31 (.1)
AT5G24550 135 / 6e-38 BGLU32 beta glucosidase 32 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020232 305 / 3e-103 AT5G36890 699 / 0.0 beta glucosidase 42 (.1.2)
Lus10026861 270 / 7e-94 AT5G36890 236 / 4e-76 beta glucosidase 42 (.1.2)
Lus10031808 154 / 7e-45 AT2G44480 560 / 0.0 beta glucosidase 17 (.1.2)
Lus10031234 152 / 3e-44 AT2G44480 563 / 0.0 beta glucosidase 17 (.1.2)
Lus10031235 149 / 7e-43 AT2G44450 590 / 0.0 beta glucosidase 15 (.1)
Lus10009644 147 / 3e-42 AT3G18080 812 / 0.0 B-S glucosidase 44 (.1)
Lus10009218 147 / 1e-41 AT5G04240 993 / 0.0 EARLY FLOWERING 6, Zinc finger (C2H2 type) family protein / transcription factor jumonji (jmj) family protein (.1)
Lus10036885 145 / 1e-41 AT1G26560 778 / 0.0 beta glucosidase 40 (.1)
Lus10037098 145 / 1e-41 AT1G26560 785 / 0.0 beta glucosidase 40 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G178800 249 / 1e-81 AT5G36890 714 / 0.0 beta glucosidase 42 (.1.2)
Potri.004G040700 155 / 1e-45 AT5G44640 548 / 0.0 beta glucosidase 13 (.1)
Potri.003G211100 154 / 7e-45 AT5G44640 569 / 0.0 beta glucosidase 13 (.1)
Potri.T085301 154 / 8e-45 AT5G44640 575 / 0.0 beta glucosidase 13 (.1)
Potri.004G109699 145 / 8e-43 AT5G44640 288 / 5e-94 beta glucosidase 13 (.1)
Potri.010G159900 146 / 4e-42 AT1G26560 795 / 0.0 beta glucosidase 40 (.1)
Potri.001G223724 145 / 7e-42 AT2G44480 524 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G223720 145 / 8e-42 AT2G44480 527 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G222800 145 / 8e-42 AT2G44480 528 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G222900 145 / 9e-42 AT2G44480 526 / 0.0 beta glucosidase 17 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Representative CDS sequence
>Lus10020234 pacid=23141983 polypeptide=Lus10020234 locus=Lus10020234.g ID=Lus10020234.BGIv1.0 annot-version=v1.0
ATGTTTCTCATTTCCACTGTGTCATCAGATGAATGGGAAGACGGAGAACCAATTGGTGAGAAGGCTGCATCGGAATGGCTATACGTTTGCCCATGGGGAC
TGAGGAAGGTCCTGAATTACGTAGCCAAGACATACAAATCCCCCAAAATATATATAACAGAGAATGGGATGGACGATGAAGACAGCGATGCGCCACTTGA
GGAAATGCTGGATGATAAGATGAGAGTACGCTACTTCAAAGGGTACCTTAAAGCGGTAGCAGAGGCAATCAGAGATGGAGTGGATGTGAAGGGTTACTTT
GCATGGTCGTTGCTGGACAACTTCGAGTGGGCGCAAGGTTACACCAAGCGATTTGGGATAGTGTACGTGGACTACAAGGACGGGGAGCTGACTCGCCACC
CAAAGTCGTCTGCATATTGGTTCTTGAGGTTCCTTAAGGGTGGTGAGGAAGGGAAAGACACAAAACAAGAATGA
AA sequence
>Lus10020234 pacid=23141983 polypeptide=Lus10020234 locus=Lus10020234.g ID=Lus10020234.BGIv1.0 annot-version=v1.0
MFLISTVSSDEWEDGEPIGEKAASEWLYVCPWGLRKVLNYVAKTYKSPKIYITENGMDDEDSDAPLEEMLDDKMRVRYFKGYLKAVAEAIRDGVDVKGYF
AWSLLDNFEWAQGYTKRFGIVYVDYKDGELTRHPKSSAYWFLRFLKGGEEGKDTKQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G36890 BGLU42 beta glucosidase 42 (.1.2) Lus10020234 0 1
AT2G15570 TRX-M3, GAT1, A... THIOREDOXIN-M3, GFP ARRESTED T... Lus10014069 10.1 0.8442
AT3G12110 ACT11 actin-11 (.1) Lus10004956 10.2 0.8606
AT4G13940 MEE58, EMB1395,... MATERNAL EFFECT EMBRYO ARREST ... Lus10022560 13.1 0.8505
AT1G65560 Zinc-binding dehydrogenase fam... Lus10040589 16.7 0.7553
AT5G64090 unknown protein Lus10020420 16.9 0.8420
AT4G13940 MEE58, EMB1395,... MATERNAL EFFECT EMBRYO ARREST ... Lus10016645 22.6 0.8352
AT3G63210 MARD1 MEDIATOR OF ABA-REGULATED DORM... Lus10022073 25.0 0.8120
AT2G36530 ENO2, LOS2 LOW EXPRESSION OF OSMOTICALLY ... Lus10002844 29.8 0.8378
AT5G16510 RGP5 reversibly glycosylated protei... Lus10020379 31.9 0.8262
AT4G39820 Tetratricopeptide repeat (TPR)... Lus10025185 33.6 0.8203

Lus10020234 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.