Lus10020253 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43620 43 / 3e-05 Chitinase family protein (.1)
AT3G54420 41 / 0.0002 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
AT2G43580 41 / 0.0002 Chitinase family protein (.1)
AT2G43570 41 / 0.0002 CHI "chitinase, putative", chitinase, putative (.1)
AT2G43610 41 / 0.0002 Chitinase family protein (.1)
AT2G43600 41 / 0.0002 Chitinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001773 191 / 2e-62 AT2G43570 51 / 6e-08 "chitinase, putative", chitinase, putative (.1)
Lus10020338 71 / 5e-16 AT2G43620 57 / 2e-10 Chitinase family protein (.1)
Lus10001772 63 / 4e-13 AT2G43610 44 / 5e-06 Chitinase family protein (.1)
Lus10014253 44 / 5e-06 AT2G43570 46 / 1e-06 "chitinase, putative", chitinase, putative (.1)
Lus10025948 44 / 3e-05 AT2G43610 50 / 3e-07 Chitinase family protein (.1)
Lus10003585 41 / 3e-05 AT3G12500 47 / 1e-07 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Lus10028377 41 / 0.0002 AT3G12500 393 / 1e-137 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Lus10006552 40 / 0.0003 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Lus10003584 39 / 0.0003 AT2G43610 44 / 2e-06 Chitinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G093800 43 / 4e-05 AT3G54420 369 / 8e-130 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.004G182000 42 / 5e-05 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.009G141700 42 / 9e-05 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.009G142300 40 / 0.0005 AT3G12500 340 / 1e-116 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.009G142000 40 / 0.0005 AT3G12500 346 / 6e-119 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.005G054000 39 / 0.0005 AT3G04720 238 / 9e-81 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Potri.013G041900 39 / 0.0006 AT3G04720 251 / 1e-85 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Potri.009G141800 39 / 0.0008 AT3G12500 351 / 9e-121 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.013G041600 39 / 0.0008 AT3G04720 266 / 3e-91 HEVEIN-LIKE, pathogenesis-related 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00187 Chitin_bind_1 Chitin recognition protein
Representative CDS sequence
>Lus10020253 pacid=23144186 polypeptide=Lus10020253 locus=Lus10020253.g ID=Lus10020253.BGIv1.0 annot-version=v1.0
ATGGAAAAATCAGCGACCGATGCTGCATTTCTGTCCCTAATAGTGGTATTATTCGTGACAACAGTGTTTTCCTCTGTCGCTAATGGTCAGGACTGCGGCG
AAGATGGCCACAACGCCCGTTGCTCGGGCGACAACTGTTGCAGCCAGAGTAGCTGGTGTGGGATCTCTGACGGACACTGCGGTGACGGCTGTCAGGCGGG
CTTCGGAAAGTGCTCGTCGTCCGGTGGCGGCAGCGGTGTCCCCGGTCCAGATCCCAGCATATCCTTCTTCGAATTGGACGATGGACGATATTCGCCACCG
GAGCCGATAATGAAGAACCTCACGCACGAAGACAGTTATTACAACACTCCAAACTGCGGGAGTCAGGCCGGCGGTAAAGAGTGTGAAGATACAAAATACT
GCTGCAGTCACTTTGGTTTCTGCGGGGAAACGGATAAGTATTGTGGCAAGATGTGCCAGTCAGGCCCGTGTACTGGCGGCGGCGGCGGACAAAATCCCAA
GACTCCATCGCCGTCTAACTGA
AA sequence
>Lus10020253 pacid=23144186 polypeptide=Lus10020253 locus=Lus10020253.g ID=Lus10020253.BGIv1.0 annot-version=v1.0
MEKSATDAAFLSLIVVLFVTTVFSSVANGQDCGEDGHNARCSGDNCCSQSSWCGISDGHCGDGCQAGFGKCSSSGGGSGVPGPDPSISFFELDDGRYSPP
EPIMKNLTHEDSYYNTPNCGSQAGGKECEDTKYCCSHFGFCGETDKYCGKMCQSGPCTGGGGGQNPKTPSPSN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G43610 Chitinase family protein (.1) Lus10020253 0 1
AT5G12180 CPK17 calcium-dependent protein kina... Lus10000889 4.5 1.0000
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10000843 4.8 1.0000
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10003277 5.5 1.0000
AT3G49210 O-acyltransferase (WSD1-like) ... Lus10022417 7.7 1.0000
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10001774 8.0 1.0000
Lus10022529 8.1 1.0000
AT2G36780 UDP-Glycosyltransferase superf... Lus10022628 8.4 1.0000
Lus10022894 8.7 1.0000
Lus10002413 9.5 1.0000
AT3G49055 unknown protein Lus10011651 9.5 1.0000

Lus10020253 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.