Plant FIBer expression Database

Lus10020268 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03960 146 / 7e-43 TCP-1/cpn60 chaperonin family protein (.1)
AT4G08640 37 / 0.0006 ATP binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002625
[exp]
170 / 8e-52 AT3G03960 936 / 0.0 TCP-1/cpn60 chaperonin family protein (.1)
Lus10007430
[exp]
163 / 4e-49 AT3G03960 952 / 0.0 TCP-1/cpn60 chaperonin family protein (.1)
Lus10010670
[exp]
156 / 2e-46 AT3G03960 952 / 0.0 TCP-1/cpn60 chaperonin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G034200
[exp]
152 / 6e-45 AT3G03960 922 / 0.0 TCP-1/cpn60 chaperonin family protein (.1)
Potri.013G058500
[exp]
150 / 4e-44 AT3G03960 922 / 0.0 TCP-1/cpn60 chaperonin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family
Representative CDS sequence
>Lus10020268 pacid=23144181 polypeptide=Lus10020268 locus=Lus10020268.g ID=Lus10020268.BGIv1.0 annot-version=v1.0
ATGGGACTGCATCCCAGTGGGATTATCAGTGGGTACACCAAGGCCAGTGACAAGTATTCTGTGAGAGCTGCTGTTGCTAGCAAACAGTTTGGCCAGGAAG
ATGTTTTGTGTAATCTTATTGCTGATGCCTGCATACCAGTTTGCCCCAAGAACCCGGCGAGCTTCAATGTGGATAACATCCGTGTTGCAAAGCTCGTGGG
AGGAGGCTTGCGCTATAGTGCCATAGTTCGAGGAATGGTCTTGAAAAGTGATGCTGTTGGCACAATGAAGAAAATCGAGAAGGCCAAGGCGAGCATTTTT
TTCCCCTCTCTTTGA
AA sequence
>Lus10020268 pacid=23144181 polypeptide=Lus10020268 locus=Lus10020268.g ID=Lus10020268.BGIv1.0 annot-version=v1.0
MGLHPSGIISGYTKASDKYSVRAAVASKQFGQEDVLCNLIADACIPVCPKNPASFNVDNIRVAKLVGGGLRYSAIVRGMVLKSDAVGTMKKIEKAKASIF
FPSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G03960 TCP-1/cpn60 chaperonin family ... Lus10020268
[exp]
0 1
AT3G52610 unknown protein Lus10022698
[exp]
7.5 0.9542
AT5G61850 LFY LFY3, LFY LEAFY 3, floral meristem ident... Lus10022427
[exp]
10.3 0.9538
AT1G78955 CAMS1 camelliol C synthase 1 (.1) Lus10026079
[exp]
13.3 0.9527
AT5G15800 MADS AGL2, SEP1 SEPALLATA1, AGAMOUS-like 2, K-... Lus10034663
[exp]
14.8 0.9485
AT1G01920 SET domain-containing protein ... Lus10019677
[exp]
15.0 0.7867
AT1G08465 YABBY YAB2 YABBY2, Plant-specific transcr... Lus10008374
[exp]
17.2 0.9483
Lus10011636
[exp]
18.0 0.9480
AT3G16970 Plant self-incompatibility pro... Lus10011753
[exp]
19.4 0.9480
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10011892
[exp]
20.8 0.9480
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10004067
[exp]
22.0 0.9480

Lus10020268 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.