Lus10020274 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002619 160 / 1e-47 AT3G62800 162 / 6e-46 double-stranded-RNA-binding protein 4 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G061500 55 / 3e-09 AT3G62800 162 / 3e-45 double-stranded-RNA-binding protein 4 (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10020274 pacid=23144120 polypeptide=Lus10020274 locus=Lus10020274.g ID=Lus10020274.BGIv1.0 annot-version=v1.0
ATGTTCGATCTCATTTGCATGTCTTCTTGGTTAGACAACTCGAATCAGAGCTCTAATCAACTCGTTCATCATCAGTACGTCCCGCCTCAACCGTCCATGC
CAATCAAACAAATGGAATCCATGGGCAACTCGAGTGGGAGCAAAAGAAAACAAGAGCCTCACTTCCCATTTCCGAGTAACTCAATTCTTCTCGAGCATCT
TCATCGGCATATCCAGTCTGAACGTGCTGCATCATCCGAAAAAGGCACTGAGCCATCTGTTACCCAACCCTGTTCAAAAATCAACACTGTCCTCGTAAAC
CCTCCAGTTGGCCAAGCCTCTTCCTCCACTAAAGGAGGTATAAGTTCGAGTGTCCAACATCTTATTGGAACCAGCATTCAACAGCAGAACAGGATCGTGG
TTCATCCTCGAAACGTCAGTGTCGCTTACCCTAATGGCAGCAACGTGCTACCGATCAGCGATGATGATTGA
AA sequence
>Lus10020274 pacid=23144120 polypeptide=Lus10020274 locus=Lus10020274.g ID=Lus10020274.BGIv1.0 annot-version=v1.0
MFDLICMSSWLDNSNQSSNQLVHHQYVPPQPSMPIKQMESMGNSSGSKRKQEPHFPFPSNSILLEHLHRHIQSERAASSEKGTEPSVTQPCSKINTVLVN
PPVGQASSSTKGGISSSVQHLIGTSIQQQNRIVVHPRNVSVAYPNGSNVLPISDDD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10020274 0 1
Lus10036784 1.0 0.9333
AT3G18200 nodulin MtN21 /EamA-like trans... Lus10021200 2.4 0.9213
AT5G38760 Late embryogenesis abundant pr... Lus10026292 3.2 0.9325
AT5G16600 MYB ATMYB43 myb domain protein 43 (.1) Lus10010974 4.0 0.9149
AT4G12320 CYP706A6 "cytochrome P450, family 706, ... Lus10024572 7.1 0.7894
Lus10024863 8.7 0.7541
AT5G44440 FAD-binding Berberine family p... Lus10003646 10.2 0.7682
AT4G30880 Bifunctional inhibitor/lipid-t... Lus10016357 19.6 0.8875
Lus10023136 23.5 0.8442
AT4G31350 Core-2/I-branching beta-1,6-N-... Lus10026959 29.5 0.6863

Lus10020274 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.