Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G33340 109 / 2e-29 CDR1 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) AT2G35615 106 / 3e-28 Eukaryotic aspartyl protease family protein (.1) AT1G31450 104 / 1e-27 Eukaryotic aspartyl protease family protein (.1) AT1G64830 102 / 7e-27 Eukaryotic aspartyl protease family protein (.1) AT2G03200 64 / 7e-13 Eukaryotic aspartyl protease family protein (.1) AT2G28030 60 / 1e-11 Eukaryotic aspartyl protease family protein (.1) AT2G28010 57 / 9e-11 Eukaryotic aspartyl protease family protein (.1) AT2G28220 54 / 2e-09 Eukaryotic aspartyl protease family protein (.1) AT2G28040 51 / 1e-08 Eukaryotic aspartyl protease family protein (.1) AT1G01300 50 / 3e-08 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002611 [exp] 209 / 2e-67 AT5G33340 392 / 9e-134 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10020277 [exp] 193 / 1e-64 AT5G33340 84 / 3e-19 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10002612 [exp] 182 / 1e-56 AT5G33340 393 / 5e-134 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10002613 [exp] 172 / 7e-53 AT5G33340 406 / 4e-139 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024905 [exp] 155 / 1e-49 AT5G33340 191 / 2e-59 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10022917 [exp] 156 / 4e-48 AT2G03200 194 / 2e-58 Eukaryotic aspartyl protease family protein (.1) Lus10022912 [exp] 158 / 8e-48 AT5G33340 450 / 1e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024903 [exp] 155 / 3e-46 AT5G33340 449 / 3e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024910 [exp] 151 / 4e-45 AT5G33340 452 / 2e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G087900 [exp] 112 / 2e-30 AT5G33340 430 / 8e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.014G114400 [exp] 107 / 8e-29 AT5G33340 475 / 1e-166 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.003G105300 [exp] 97 / 9e-25 AT2G35615 414 / 2e-142 Eukaryotic aspartyl protease family protein (.1) Potri.019G002100 [exp] 60 / 2e-11 AT2G03200 529 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.001G306200 [exp] 60 / 2e-11 AT2G03200 501 / 1e-176 Eukaryotic aspartyl protease family protein (.1) Potri.002G171700 [exp] 53 / 5e-09 AT1G01300 642 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.014G099400 [exp] 52 / 7e-09 AT1G01300 633 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.016G000600 [exp] 49 / 1e-07 AT5G10770 286 / 2e-91 Eukaryotic aspartyl protease family protein (.1) Potri.018G014800 [exp] 48 / 2e-07 AT5G10770 312 / 9e-102 Eukaryotic aspartyl protease family protein (.1) Potri.018G014600 [exp] 45 / 2e-06 AT5G10770 371 / 1e-124 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020278 pacid=23144157 polypeptide=Lus10020278 locus=Lus10020278.g ID=Lus10020278.BGIv1.0 annot-version=v1.0 ATGATCGTGCCTACCGATTTCTTCTCCGATTTTACCACTGCAGTCGAGGCACTAGTGACAGGCGGGAGCAAGACCAGCGACCCGCAAGGATTCCTCAACT TATGCTACGTGATAGACCCGAAACTCGAGATCCCTCCAGTTGCCATGTATTTCAAAGGAGGTGGCGTGGAGTTGAATTCGATCAACCTCTTCGTTCCGAT GAGCGAAACGGTGACATGTCTCGCTTTCTACGGTAGTGACGTGGTGAGCATTTACGGGAACTTAGCGCAGCAAGATTTTCTGGTCGGCTACGACCTTCAG AAGCGGACCGTGACCTTCAAACCTACAGATTGCATCCAGAACTAA
AA sequence Show only first row Show all	>Lus10020278 pacid=23144157 polypeptide=Lus10020278 locus=Lus10020278.g ID=Lus10020278.BGIv1.0 annot-version=v1.0 MIVPTDFFSDFTTAVEALVTGGSKTSDPQGFLNLCYVIDPKLEIPPVAMYFKGGGVELNSINLFVPMSETVTCLAFYGSDVVSIYGNLAQQDFLVGYDLQ KRTVTFKPTDCIQN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10020278 [exp]	0	1

Compare expression of checked genes

Lus10020278 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.