Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56520 46 / 4e-08 unknown protein AT1G55365 40 / 1e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005700 [exp] 144 / 6e-47 AT5G56520 50 / 1e-09 unknown protein Lus10013409 [exp] 52 / 5e-10 AT1G55365 87 / 9e-23 unknown protein Lus10010316 [exp] 40 / 2e-05 AT1G55365 85 / 5e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G057832 [exp] 101 / 4e-30 ND / Potri.013G057766 [exp] 94 / 3e-27 ND / Potri.001G003500 [exp] 52 / 2e-10 AT5G56520 72 / 1e-17 unknown protein Potri.003G221500 [exp] 48 / 8e-09 AT5G56520 79 / 2e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020285 pacid=23144140 polypeptide=Lus10020285 locus=Lus10020285.g ID=Lus10020285.BGIv1.0 annot-version=v1.0 ATGGCGGTGACGGTGGCCGGAGTATCAGCAAGCTTATGCCAGTACATCGCCTGCAATCCAGAACGCCTCCCGAGCGATCAAGTCCTCCACCTAATCTTCT GCCTCCCTGCCCAGCAACTCGGCCGCGTCGCCATCTCCCTCTGGACGTATCTCTGCTACAACCCTAACCCGGCCAATTACGTCACCGATCTCGACTCGTC CGACTCCGATTAA
AA sequence Show only first row Show all	>Lus10020285 pacid=23144140 polypeptide=Lus10020285 locus=Lus10020285.g ID=Lus10020285.BGIv1.0 annot-version=v1.0 MAVTVAGVSASLCQYIACNPERLPSDQVLHLIFCLPAQQLGRVAISLWTYLCYNPNPANYVTDLDSSDSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G56520			unknown protein		Lus10020285 [exp]	0	1
AT3G10400		U11/U12-31K	U11/U12-31K, RNA recognition m...		Lus10037960 [exp]	8.1	0.8423
AT5G18610			Protein kinase superfamily pro...		Lus10012814 [exp]	14.3	0.8509
AT2G37480			unknown protein		Lus10003982 [exp]	18.7	0.8636
AT4G31130			Protein of unknown function (D...		Lus10026052 [exp]	20.4	0.8675
AT4G24210		SLY1	SLEEPY1, F-box family protein ...		Lus10042637 [exp]	25.1	0.8199
AT4G08455			BTB/POZ domain-containing prot...		Lus10029732 [exp]	27.1	0.8620
AT1G51550			Kelch repeat-containing F-box ...		Lus10034827 [exp]	27.7	0.8531
AT3G51100			unknown protein		Lus10041813 [exp]	32.4	0.8508
AT5G03670			unknown protein		Lus10023875 [exp]	32.9	0.7877
AT5G50380		ATEXO70F1	exocyst subunit exo70 family p...		Lus10016764 [exp]	50.2	0.8426

Compare expression of checked genes

Lus10020285 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.