Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18150 108 / 6e-33 Methyltransferase-related protein (.1) AT5G14602 96 / 1e-27 unknown protein AT5G58375 70 / 2e-17 Methyltransferase-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005698 [exp] 166 / 3e-55 AT5G18150 108 / 1e-32 Methyltransferase-related protein (.1) Lus10034423 [exp] 91 / 1e-25 AT5G18150 87 / 5e-24 Methyltransferase-related protein (.1) Lus10019138 [exp] 88 / 3e-24 AT5G18150 80 / 3e-21 Methyltransferase-related protein (.1) Lus10042227 [exp] 67 / 3e-16 AT5G58375 91 / 2e-25 Methyltransferase-related protein (.1) Lus10008585 [exp] 67 / 3e-16 AT5G58375 89 / 1e-24 Methyltransferase-related protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G058200 [exp] 121 / 1e-37 AT5G18150 114 / 5e-35 Methyltransferase-related protein (.1) Potri.019G035000 [exp] 116 / 8e-36 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1) Potri.013G155800 [exp] 67 / 6e-16 AT5G58375 67 / 5e-16 Methyltransferase-related protein (.1) Potri.019G127900 [exp] 57 / 2e-12 AT5G58375 64 / 6e-15 Methyltransferase-related protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10020287 pacid=23144103 polypeptide=Lus10020287 locus=Lus10020287.g ID=Lus10020287.BGIv1.0 annot-version=v1.0 ATGTGTCCTATGAGGTTCATCCTGGTCTTCTTCTCTGCAATTCTGGCAGGCTACTTCGCCTGGAAGACGGTGAGCACTTCTCCGGCCGACGACGAAAACT CCGGTGATTCGACGGCCGACAAGGCTGCTACTGATGTCAAGAAGCAGGAATCCAGCATGGTCAAGATGCTTCAGAACGGGTTCTGGGTGTTTGTGGACAT GGCGAGTGGGAGGTACCTATGGAGAAACATCAAGGAAATGAAGAAGCAAGAGAATTCATGA
AA sequence Show only first row Show all	>Lus10020287 pacid=23144103 polypeptide=Lus10020287 locus=Lus10020287.g ID=Lus10020287.BGIv1.0 annot-version=v1.0 MCPMRFILVFFSAILAGYFAWKTVSTSPADDENSGDSTADKAATDVKKQESSMVKMLQNGFWVFVDMASGRYLWRNIKEMKKQENS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18150			Methyltransferase-related prot...		Lus10020287 [exp]	0	1
AT5G13700		ATPAO1, APAO	polyamine oxidase 1 (.1)		Lus10029495 [exp]	1.7	0.9470
AT5G53110			RING/U-box superfamily protein...		Lus10023086 [exp]	4.6	0.9400
AT5G57190		PSD2	phosphatidylserine decarboxyla...		Lus10010761 [exp]	4.9	0.9340
AT2G02800		Kin2, APK2B	protein kinase 2B (.1.2)		Lus10022591 [exp]	6.0	0.9411
AT5G65495			unknown protein		Lus10002656 [exp]	6.9	0.9396
AT5G13700		ATPAO1, APAO	polyamine oxidase 1 (.1)		Lus10039599 [exp]	13.5	0.9339
AT5G25880		ATNADP-ME3	Arabidopsis thaliana NADP-mali...		Lus10043025 [exp]	13.8	0.9098
AT5G06720		ATPA2	peroxidase 2 (.1)		Lus10004163 [exp]	13.9	0.9242
AT1G01490			Heavy metal transport/detoxifi...		Lus10028762 [exp]	14.1	0.9158
AT2G02800		Kin2, APK2B	protein kinase 2B (.1.2)		Lus10021489 [exp]	15.3	0.9343

Compare expression of checked genes

Lus10020287 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.