Lus10020295 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G26790 74 / 9e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G13800 73 / 2e-15 FAC19 embryonic factor 19, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G62680 71 / 1e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62670 65 / 2e-12 RPF2 rna processing factor 2 (.1)
AT1G31840 64 / 2e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G62930 64 / 3e-12 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G63400 63 / 6e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63130 63 / 6e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G11690 62 / 8e-12 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G64580 62 / 1e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020298 314 / 7e-109 AT2G26790 208 / 1e-60 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10005692 311 / 1e-102 AT2G26790 469 / 4e-154 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10007468 68 / 1e-13 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028943 66 / 2e-13 AT5G01110 299 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027974 61 / 4e-11 AT1G19290 480 / 1e-156 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10023863 61 / 5e-11 AT5G12100 728 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10008185 60 / 1e-10 AT1G19290 864 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10004892 58 / 4e-10 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10019081 57 / 7e-10 AT5G61400 406 / 7e-137 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G066600 94 / 1e-22 AT2G26790 521 / 4e-174 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G014500 64 / 2e-12 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.001G276500 64 / 4e-12 AT5G01110 863 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G105400 62 / 1e-11 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G250700 59 / 1e-10 AT3G54980 781 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G141800 59 / 2e-10 AT2G06000 588 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2)
Potri.019G019300 58 / 4e-10 AT3G04760 776 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.001G243800 58 / 4e-10 AT5G59600 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G105700 57 / 6e-10 AT4G19440 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.007G068400 57 / 7e-10 AT3G22470 300 / 8e-96 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10020295 pacid=23144149 polypeptide=Lus10020295 locus=Lus10020295.g ID=Lus10020295.BGIv1.0 annot-version=v1.0
ATGAGAAAGATAGGAGGGTTGGATCTCTGTAACGCCATGGTTAACGGCTGCTGCTGTATGAAAAGCGTCAAAAAAGCGCTTAGACTGTTTGTTTCTGTGT
CGCAACAGGGGTATATACTAAAGAAGAGTACTTGTTTGAAGGTTATTTCCAGTTTGGAATACGATATGGCGAAATACGTCCAGCTGGCGGAGACGATGCT
AAATCTAGAAGCGGATTATTCGTGTATGTTATGCAGCAGGATCATCGGAAAGCTTTCTCGTGCCGGAGAAATGGAAAAGGCCAGATACGTACTGCATCTT
CTCGATCGGAGAGAGATGAGCGCCGATCTGGTGGCGTACACGATGATGATACAGGGCTATTGCAGGGTAAATCAGCTGGAAGAGGGCTTCAAGGTTCTTG
ACGAAATGAAGAAACGAGGGATCGAACTGGAGATTGTGACTTTCATGGTTTTGCTCGACGGGGCGTTGAAGAATTCTGACGGGAGCAGAAGGAAACAGGA
GGCAGATGATTTTTAG
AA sequence
>Lus10020295 pacid=23144149 polypeptide=Lus10020295 locus=Lus10020295.g ID=Lus10020295.BGIv1.0 annot-version=v1.0
MRKIGGLDLCNAMVNGCCCMKSVKKALRLFVSVSQQGYILKKSTCLKVISSLEYDMAKYVQLAETMLNLEADYSCMLCSRIIGKLSRAGEMEKARYVLHL
LDRREMSADLVAYTMMIQGYCRVNQLEEGFKVLDEMKKRGIELEIVTFMVLLDGALKNSDGSRRKQEADDF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G26790 Pentatricopeptide repeat (PPR)... Lus10020295 0 1
AT3G62080 SNF7 family protein (.1.2) Lus10009262 5.1 0.7272
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Lus10024315 12.6 0.6483
AT1G01140 PKS6, CIPK9, Sn... SNF1-RELATED PROTEIN KINASE 3.... Lus10002692 24.7 0.6666
Lus10011286 48.5 0.6215
AT2G38660 Amino acid dehydrogenase famil... Lus10043398 61.2 0.6429
AT3G59510 Leucine-rich repeat (LRR) fami... Lus10027040 76.9 0.6307
AT5G60540 EMB2407, ATPDX2... EMBRYO DEFECTIVE 2407, pyridox... Lus10034326 141.3 0.5552
AT2G46760 D-arabinono-1,4-lactone oxidas... Lus10010105 148.0 0.5571
AT5G40380 CRK42 cysteine-rich RLK (RECEPTOR-li... Lus10036028 185.5 0.5412
AT5G52390 PAR1 protein (.1) Lus10040702 204.3 0.5567

Lus10020295 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.