Plant FIBer expression Database

Lus10020301 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G35910 44 / 5e-06 Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005691
[exp]
92 / 7e-23 AT5G35910 814 / 0.0 Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain (.1)
Lus10039170
[exp]
90 / 5e-22 AT5G35910 828 / 0.0 Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G038701
[exp]
56 / 5e-10 AT5G35910 846 / 0.0 Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain (.1)
Potri.013G062800
[exp]
55 / 6e-10 AT5G35910 791 / 0.0 Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain (.1)
PFAM info
Representative CDS sequence
>Lus10020301 pacid=23144074 polypeptide=Lus10020301 locus=Lus10020301.g ID=Lus10020301.BGIv1.0 annot-version=v1.0
ATGGACATCGATCAACCGAATCAACCACTACAGTCCCAATCCCAAACCCTAACCACATTAACCACCGACCCTCTCTCCTCGTCACTCTCATCCCTCGCCG
CATCTTCCCGCGCATTCCCTTCCAACAAGGACTTCCACTTCTACAACAACTTCGAGGAGTTCAAACACCCCGTCAACCGAATCGCGTCCAAGTCTCAGTC
CCTCCTCGGTTCAATCGGGGTCTCGGGGTCCGTCTTCAAGCAGAGTTACACATTCCCAACCGACATTGACTGCGACCGTACGTGCCCCCGCCGACGCGCC
GTACGGGCTCCCCAACGCCAACGACGAGGTGCTTGA
AA sequence
>Lus10020301 pacid=23144074 polypeptide=Lus10020301 locus=Lus10020301.g ID=Lus10020301.BGIv1.0 annot-version=v1.0
MDIDQPNQPLQSQSQTLTTLTTDPLSSSLSSLAASSRAFPSNKDFHFYNNFEEFKHPVNRIASKSQSLLGSIGVSGSVFKQSYTFPTDIDCDRTCPRRRA
VRAPQRQRRGA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G35910 Polynucleotidyl transferase, r... Lus10020301
[exp]
0 1
AT1G10270 GRP23 glutamine-rich protein 23 (.1) Lus10024470
[exp]
4.4 0.8942
AT1G68990 MGP3 male gametophyte defective 3 (... Lus10019207
[exp]
14.6 0.8631
AT1G53050 Protein kinase superfamily pro... Lus10035892
[exp]
21.1 0.8576
AT5G18810 SCL28, At-SCL28 SC35-like splicing factor 28 (... Lus10012783
[exp]
22.8 0.8332
AT3G19740 P-loop containing nucleoside t... Lus10040976
[exp]
24.7 0.8460
AT1G29350 Kinase-related protein of unkn... Lus10025382
[exp]
25.8 0.8501
AT1G14850 NUP155 nucleoporin 155 (.1) Lus10001585
[exp]
27.9 0.8590
AT2G06990 HEN2 hua enhancer 2, RNA helicase, ... Lus10022944
[exp]
31.2 0.8545
AT3G14120 unknown protein Lus10037684
[exp]
36.9 0.8511
AT3G60400 Mitochondrial transcription te... Lus10013142
[exp]
39.7 0.8049

Lus10020301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.