Lus10020311 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G17820 137 / 4e-40 Peroxidase superfamily protein (.1)
AT4G26010 134 / 5e-39 Peroxidase superfamily protein (.1)
AT3G03670 127 / 2e-36 Peroxidase superfamily protein (.1)
AT5G22410 127 / 2e-36 RHS18 root hair specific 18 (.1)
AT1G34510 124 / 2e-35 Peroxidase superfamily protein (.1)
AT4G11290 120 / 1e-33 Peroxidase superfamily protein (.1)
AT5G64110 120 / 2e-33 Peroxidase superfamily protein (.1)
AT1G05260 119 / 2e-33 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
AT5G64100 119 / 3e-33 Peroxidase superfamily protein (.1)
AT4G16270 114 / 5e-31 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005681 230 / 2e-76 AT5G17820 294 / 9e-99 Peroxidase superfamily protein (.1)
Lus10005679 152 / 6e-46 AT4G26010 353 / 3e-122 Peroxidase superfamily protein (.1)
Lus10020312 158 / 2e-45 AT1G04170 845 / 0.0 eukaryotic translation initiation factor 2 gamma subunit (.1)
Lus10001324 144 / 7e-43 AT5G17820 327 / 6e-112 Peroxidase superfamily protein (.1)
Lus10013631 142 / 4e-42 AT5G17820 331 / 2e-113 Peroxidase superfamily protein (.1)
Lus10004859 131 / 8e-38 AT5G22410 309 / 1e-104 root hair specific 18 (.1)
Lus10043010 129 / 8e-37 AT5G22410 300 / 9e-101 root hair specific 18 (.1)
Lus10018375 128 / 1e-36 AT5G17820 293 / 1e-98 Peroxidase superfamily protein (.1)
Lus10032511 125 / 2e-35 AT5G22410 302 / 8e-102 root hair specific 18 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G066800 137 / 6e-40 AT4G26010 360 / 1e-124 Peroxidase superfamily protein (.1)
Potri.015G110200 132 / 4e-38 AT5G22410 340 / 1e-116 root hair specific 18 (.1)
Potri.007G122451 121 / 5e-34 AT5G15180 374 / 3e-130 Peroxidase superfamily protein (.1)
Potri.007G122301 118 / 7e-33 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122250 118 / 7e-33 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122401 118 / 7e-33 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122351 118 / 7e-33 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.T045500 117 / 1e-32 AT4G33420 441 / 9e-157 Peroxidase superfamily protein (.1)
Potri.018G136900 117 / 1e-32 AT4G33420 451 / 1e-160 Peroxidase superfamily protein (.1)
Potri.003G214700 117 / 2e-32 AT5G06720 459 / 5e-163 peroxidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10020311 pacid=23144075 polypeptide=Lus10020311 locus=Lus10020311.g ID=Lus10020311.BGIv1.0 annot-version=v1.0
ATGTTCGTCGATCCATCCGTCACCGCCGCCCTCCTCCGCATCCACTTCCACGACTGCTTCTCCAAGGGCTGCGACGCGTCCATCCTGATCCACCCGACGC
CGCAAAACCCGACCCCACAAAAGACGGCGCCGCCGAACAGGTCCGTACGAGGTTTCAACATCATCGACGCCGTCAAAGGTGCTTTAGAGCTCGCCTGCCC
TGCCACCGTCTCGTGCGCTGATGCTATCGCGCTCGCCACGGGTGACGCAGTCGCTCTATCCTCCGGCGGAGGCATTAGGTACTCCGTCCCGACAGGACGG
CTCGACGAGCTTCTCTCCACGGTCGCCAACGTCAAGCTGCCGGCGCCGACTCAGTCTGTTTACTTGGCCTTCAGTCAGTTTTTCAGTACGTTCGAGTCCC
CTGCACCCAAGTTTAGAGAAAAAAGTCTATCGATAAGCTCGAGCTTGTAG
AA sequence
>Lus10020311 pacid=23144075 polypeptide=Lus10020311 locus=Lus10020311.g ID=Lus10020311.BGIv1.0 annot-version=v1.0
MFVDPSVTAALLRIHFHDCFSKGCDASILIHPTPQNPTPQKTAPPNRSVRGFNIIDAVKGALELACPATVSCADAIALATGDAVALSSGGGIRYSVPTGR
LDELLSTVANVKLPAPTQSVYLAFSQFFSTFESPAPKFREKSLSISSSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G17820 Peroxidase superfamily protein... Lus10020311 0 1
AT5G17820 Peroxidase superfamily protein... Lus10005681 1.7 0.8744
AT5G10930 CIPK5, SnRK3.24 SNF1-RELATED PROTEIN KINASE 3.... Lus10024075 3.5 0.8675
AT1G75030 ATLP-3 thaumatin-like protein 3 (.1) Lus10015705 4.6 0.8156
AT5G47430 DWNN domain, a CCHC-type zinc ... Lus10029205 6.6 0.7603
AT4G05400 copper ion binding (.1.2) Lus10031070 6.7 0.7493
AT3G51710 D-mannose binding lectin prote... Lus10009088 7.7 0.7481
AT3G49070 Protein of unknown function (D... Lus10027501 10.2 0.7479
Lus10025385 13.5 0.7481
Lus10013622 14.5 0.7420
AT4G18950 Integrin-linked protein kinase... Lus10029277 17.9 0.7049

Lus10020311 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.