Plant FIBer expression Database

Lus10020317 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09670 66 / 3e-14 Oxidoreductase family protein (.1)
AT1G34200 51 / 5e-09 Glyceraldehyde-3-phosphate dehydrogenase-like family protein (.1)
AT1G66130 39 / 9e-05 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001327
[exp]
71 / 1e-15 AT4G09670 484 / 1e-172 Oxidoreductase family protein (.1)
Lus10013633
[exp]
70 / 2e-15 AT4G09670 486 / 4e-173 Oxidoreductase family protein (.1)
Lus10005674
[exp]
0 / 1 AT4G09670 437 / 9e-154 Oxidoreductase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G200300
[exp]
77 / 3e-18 AT4G09670 522 / 0.0 Oxidoreductase family protein (.1)
Potri.005G200200
[exp]
77 / 4e-18 AT4G09670 521 / 0.0 Oxidoreductase family protein (.1)
Potri.017G137300
[exp]
57 / 4e-11 AT1G66130 382 / 2e-132 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Representative CDS sequence
>Lus10020317 pacid=23144204 polypeptide=Lus10020317 locus=Lus10020317.g ID=Lus10020317.BGIv1.0 annot-version=v1.0
ATGTCGGGGCCAAAGATCCGATGCGGGATAATCGGGTGCGCGGACATAGCCAGGAAGCTGGCCAGAGCAATCACCCTATCGCCAAACTTCGAGTTGTCCG
CCGTCGCCAGCCGCACACTTAAAAAAGCAACCGATTTCGCGGCGGCGAACAATCTGCCGTACGGTCAAGATCTACGGGTCGCACGAGTATTTGCTCGACG
ACCCGGATATAGATGCCGTGTATATCCCGTTACCCACCAGCCTTCACTTGGAGTGGGTGACTCTGGCTGCTAA
AA sequence
>Lus10020317 pacid=23144204 polypeptide=Lus10020317 locus=Lus10020317.g ID=Lus10020317.BGIv1.0 annot-version=v1.0
MSGPKIRCGIIGCADIARKLARAITLSPNFELSAVASRTLKKATDFAAANNLPYGQDLRVARVFARRPGYRCRVYPVTHQPSLGVGDSGC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G09670 Oxidoreductase family protein ... Lus10020317
[exp]
0 1
AT1G24560 unknown protein Lus10013022
[exp]
6.8 0.8918
AT2G43320 S-adenosyl-L-methionine-depend... Lus10015953
[exp]
19.0 0.8844
Lus10027730
[exp]
22.2 0.8843
AT4G36740 HD HB-5, ATHB40 homeobox protein 40 (.1) Lus10041719
[exp]
27.5 0.8802
AT2G39445 Phosphatidylinositol N-acetylg... Lus10010489
[exp]
31.9 0.8717
AT2G34470 PSKF109, UREG urease accessory protein G (.1... Lus10004922
[exp]
33.0 0.8740
AT5G03700 D-mannose binding lectin prote... Lus10014371
[exp]
33.2 0.8834
AT1G12550 HPR3 hydroxypyruvate reductase 3, D... Lus10006708
[exp]
35.3 0.8749
AT5G18610 Protein kinase superfamily pro... Lus10033966
[exp]
37.1 0.8592
AT1G75560 zinc knuckle (CCHC-type) famil... Lus10031093
[exp]
38.0 0.8651

Lus10020317 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.